Allele Report for DQB1*03:05:03

DQB1*03:05:03 View HGVS Report
Pre-2010 Nomenclature: DQB1*030503 Local Names: 108114
IMGT/HLA Acc No: HLA01744 OMIM Entry: *604305
Assigned: 2003-04-30 Sequence Last Modified: 2003-07-12
Source Entries: AJ557776 , JN135290  
Cells Sequence Derived From: 402354872 , CS00096  
Known Ethnic Origin Of Source: American Indian, Caucasoid
Publications
Velickovic ZM et al. Tissue Antigens 63:93-5 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: DQ8 WHO Assigned Type: DQ8(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 70 DQ8 [34%] DQ3 [30%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ8
Comments:
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRGVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACCGAGCGCGTGCGGGGTGTGACCAGATACATC
TATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCCGCCTGCCGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo