Allele Report for DQB1*03:04:01

DQB1*03:04:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*0304 Local Names: DQB1*03HP, DQB1*03new
IMGT/HLA Acc No: HLA00630 OMIM Entry: *604305
Assigned: 1991-11-14 Sequence Last Modified: 1998-12-16
Source Entries: M74842 , M83770 , X76553  
Cells Sequence Derived From: HP , M.M. , RG , ZM-FC  
Known Ethnic Origin Of Source: Caucasoid
Publications
Fenske TS et al. Hum Immunol 33:224-7 1992. (View abstract)
Tautz C et al. Immunogenetics 35:421-4 1992. (View abstract)
Cucca F et al. Hum Immunol 40:143-9 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 4 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: DQ7 WHO Assigned Type: DQ7(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 DQ7 [60%] DQ3 [34%]
NMDP (2008) 111 DQ7 [40%] DQ3 [35%] DQ8 [8%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ7
Comments:
Protein Sequence (199 aa)
RDSPEDFVYQFKAMCYFTNGTERVRYVTRYIYNREEYARFDSDVEVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCR
HNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVM
LEMTPQHGDVYTCHVEHPSLQNPITVEWRAQSESAQSKM
Nucleotide Sequence Data (597 bps)
AGAGACTCTCCCGAGGATTTCGTGTACCAGTTTAAGGCCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTTATGT
GACCAGATACATCTATAACCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGAGGTGTACCGGGCGGTGACGCCGCTGG
GGCCGCCTGCCGCCGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGA
CACAACTACCAGTTGGAGCTCCGCACGACCTTGCAGCGGCGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGA
GGCCCTCAACCACCACAACCTGCTGGTCTGCTCAGTGACAGATTTCTATCCAGCCCAGATCAAAGTCCGGTGGTTTCGGA
ATGACCAGGAGGAGACAACCGGCGTTGTGTCCACCCCCCTTATTAGGAACGGTGACTGGACCTTCCAGATCCTGGTGATG
CTGGAAATGACTCCCCAGCATGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAACCCCATCACCGTGGA
GTGGCGGGCTCAGTCTGAATCTGCCCAGAGCAAGATG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo