Allele Report for DQB1*03:02:04

DQB1*03:02:04 View HGVS Report
Pre-2010 Nomenclature: DQB1*030204 Local Names: 106329
IMGT/HLA Acc No: HLA02722 OMIM Entry: *604305
Assigned: 2006-11-29 Sequence Last Modified: 2007-01-12
Source Entries: AM409256  
Cells Sequence Derived From: 106329  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ8 WHO Assigned Type: DQ8(3)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 37 DQ3 [9-60%] DQ8 [24-91%] DQ7 [0-20%] DQ9 [0-9%]
NMDP (2008) 6687 DQ8 [66%] DQ3 [25%] DQ7 [4%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DQ3 DQ8
Comments:
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATC
TATAATCGAGAGGAGTACGCACGCTTCGACAGCGACGTGGGGGTGTATCGGGCGGTGACGCCGCTGGGGCCGCCTGCCGC
CGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGAGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo