Allele Report for DQB1*02:01:03

DQB1*02:01:03 View HGVS Report
Pre-2010 Nomenclature: Local Names: LCS
IMGT/HLA Acc No: HLA05758 OMIM Entry: *604305
Assigned: 2010-08-31 Sequence Last Modified: 2010-10-15
Source Entries: HM997021  
Cells Sequence Derived From: LCS  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Lee KW. Tissue Antigens 77:601-602 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACAGAGCGCGTGCGTCTTGTGAGCAGAAGCATC
TATAACCGAGAAGAGATCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCAGTGACGCTGCTGGGGCTGCCTGCCGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGAGGAAACGGGCGGCGGTGGACAGGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo