Allele Report for DQB1*02:03

DQB1*02:03 View HGVS Report
Pre-2010 Nomenclature: DQB1*0203 Local Names: DQB1*GHA30, DQB1*02DL
IMGT/HLA Acc No: HLA00624 OMIM Entry: *604305
Assigned: 1995-11-08 Sequence Last Modified: 2007-04-12
Source Entries: AB002468 , U33329 , U39089 , U39090 , Z35099  
Cells Sequence Derived From: CAUCA254 , CAUCA288 , DL-13 , GHA30 , RAQ  
Known Ethnic Origin Of Source: Black, Mixed
Publications
Trachtenberg EA et al. Tissue Antigens 48:192-8 1996. (View abstract)
Olerup O et al. Tissue Antigens 49:271-3 1997. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: DQ2 WHO Assigned Type: DQ2
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 3 DQ2 [67%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ2
Comments:  
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPDAEYWNSQKDILERKRAAVDRVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (269 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACAGAGCGCGTGCGTCTTGTGAGCAGAAGCATC
TATAACCGAGAAGAGATCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGCTGCTGGGGCTGCCTGACGC
CGAGTACTGGAACAGCCAGAAGGACATCCTGGAGAGGAAACGGGCGGCGGTGGACAGGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo