Allele Report for DQB1*02:02:01

DQB1*02:02:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*0202 Local Names: BH-2.7,
IMGT/HLA Acc No: HLA00623 OMIM Entry: *604305
Assigned: 1994-04-12 Sequence Last Modified: 1999-08-06
Source Entries: BX927168 , L34095 , M81141 , U07848  
Cells Sequence Derived From: BH , BURKHARDT , MOU  
Known Ethnic Origin Of Source: Caucasoid
Publications
Hall MA et al. Hum Immunol 38:284-92 1993. (View abstract)
Yasunaga S et al. Tissue Antigens 47:37-48 1996. (View abstract)
Karr RW et al. J Immunol 137:2886-90 1986. (View abstract)
Monos DS et al. Immunogenetics 42:172-80 1995. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 5
HLA Dictionary Data
Expert Assigned Type: DQ2 WHO Assigned Type: DQ2
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 23 DQ2 [75-100%]
NMDP (2008) 656 DQ2 [87%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: DQ2
Comments:
Protein Sequence (261 aa)
MSWKKALRIPGGLRAATVTLMLSMLSTPVAEGRDSPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFR
AVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIK
VRWFRNGQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH
Nucleotide Sequence Data (786 bps)
ATGTCTTGGAAAAAGGCTTTGCGGATCCCCGGAGGCCTTCGGGCAGCAACTGTGACCTTGATGCTGTCGATGCTGAGCAC
CCCAGTGGCTGAGGGCAGAGACTCTCCCGAGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACAG
AGCGCGTGCGTCTTGTGAGCAGAAGCATCTATAACCGAGAAGAGATCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGG
GCGGTGACGCTGCTGGGGCTGCCTGCCGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAGAGGAAACGGGCGGCGGT
GGACAGGGTGTGCAGACACAACTACCAGTTGGAGCTCCGCACGACCTTGCAGCGGCGAGTGGAGCCCACAGTGACCATCT
CCCCATCCAGGACAGAGGCCCTCAACCACCACAACCTGCTGGTCTGCTCGGTGACAGATTTCTATCCAGCCCAGATCAAA
GTCCGGTGGTTTCGGAATGGCCAGGAGGAGACAGCTGGCGTTGTGTCCACCCCCCTTATTAGGAATGGTGACTGGACCTT
CCAGATCCTGGTGATGCTGGAAATGACTCCCCAGCGTGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGA
GCCCCATCACCGTGGAGTGGCGGGCTCAATCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCATTGGAGGCTTCGTGCTG
GGGCTGATCTTCCTCGGGCTGGGCCTTATCATCCATCACAGGAGTCAGAAAGGGCTCCTGCACTGA
Genomic Sequence Data (7471 bps)
GAACTTTGCTCTTTTCACCAAAACTTAAGGCTCCTCAGGGTGTGTCTAAGACAACAGCAGTAAAAATGTCTATGACAGCA
ATTTTCTCTCCCCTGAAATATGATCCCCACTTAATTTGCCCTATTGAAAGAATCCCAAGTATAAGAACAACTGGTTTTTA
ATCAATATTACAAAGATGTTTACTGTTGAATCGCATTTTTCTTTGGCTTCTTAAAATCCCTTAGGCATTCAATCTTCAGC
TCTTCCATAATTGAGAGGAAATTTTCACCTCAAATGTTCATCCAGTGCAATTGAAAGACGTCACAGTGCCAGGCACTGGA
TTCAGAACCTTCACACAAAAAAAATCTGCCCAGAGACAGATGAGGTCCTTCAGCTCCAGTGCTGATTGGTTCCTTTCCAA
GGGACCATCCAATCCTACCACGCATGGAAACATCCACAGATTTTTATTCTTTCTGCCAGGTACATCAGATCCATCAGGTC
CGAGCTGTGTTGACTACCACTTTTCCCTTCGTCTCAATTATGTCTTGGAAAAAGGCTTTGCGGATCCCCGGAGGCCTTCG
GGCAGCAACTGTGACCTTGATGCTGTCGATGCTGAGCACCCCAGTGGCTGAGGGCAGAGACTCTCCCGGTAAGTGCAGGG
CAGCTGCTCTCCAGAGCCGCTACTCTGGGAACAGGCTCTCCTTGGGCTGGGGTACGGGGATGGTGATCTCCATAATCTCG
GACACAATCTTTTATCAACATTTCCTCTGTTTTGGGAAAGAGAGCTATGTTGCATTTCCATTTATCTTTTAATGATGAAG
TGAGGACAATCCAATCCCATCCTACAGGCTTAAGCCTGGAAGAGGAGGAGAGAGGAGAGAAAAGAGGAGACAAAGTGTTC
ATTTACTACCAGTGATAGGACAAAGTGAGCATGGGGTTATTTTTGAAGATATGAATTTCTCCAAAGACACAGCAGGATTT
GCCATTTAGGCGTGTCCCAAGACTTGCCTGGACTAAATATTATGATTTCCTGCATTGGGAAATGCAAGGCAGCAATGGTG
TCTGTAGTCTCCGTATTTGGGGAAAAGTTGTCTGTATTCCTGACCCAGTGGAGCGTTTGTGGAGGCAAAATCTTGGTACT
GAGGGAAGCTGACTGGCTGACCACAGAAAGAGAGCCTTCAGGTTTCACTGATTTATGGGCAAATGGTGACCTGAGTGGGA
TTCAGATACCCGAGTTGATGATGGACTAAATTTAGTAGAAAGGAGGATGTAAAGAAGGGAAATAACACATACTGTGAAAC
CACTCATTTCAGACACAGAACAATACTTTACATAAATTCTCTCTCACTCCTTCTAACATCCTGTGTGTAGATATCATGAT
TTTCTTTTACACAATTATACTTGTGATATGGATATTCTGTTACATAACCTGCCCGGGCTGGTGACTGCCACAGTTTAATG
GGAATCTAGTTTATCAAATTCAAAAGCTTGTGCTCTTTCGGTGAATAAATGTTTCTTTCTAGGACTCAGAGATCTAGGAC
TCCCTTCTTTCTAACACAGAAGTGAGTGAACCTCACAGGGCACTTGGGAGGGTAAATCCAGGCATGGGAAGGAAGGTATT
TTACCCAGGGACCAAGAGAATAGGCGTATCGGAAGAGGACAGGTTTAATTCCTGGACCTGTCTCGTCATTCCCTTGAACT
GTCAGGTTTATGTGGATAACTTTATCTCTGAGGTACCCAGGAGCTCCATGGAAAATGAGATTTCATGCGAGAACGCCCTG
ATCCCTCTAAGTGCAGAGGTCCATGTAAAATCAGCCCGACTGCCTCTTCACTTGGTTCACAGGCCGAGACAGGGACAGGG
CTTTCCTCCCTTTCCTGCCTTTAGGAAGGCGGATTCCCGAAGACCCCCGAGAGGGCGGGCAGGGCTGGGCAGAGCCGCCG
GGAGGATCCCAGGTCTGCAGCGCGAGGCACGGGCCGGCGGGAACTTGTGGTCGCGCGGGCTGTTCCACAGCTCCGGGCCG
GGTCAGGGTGGCGGCTGCGGGGGCGGACGGGCTGGGCCGCACTGACTGGCCGGTGATTCCTCGCAGAGGATTTCGTGTAC
CAGTTTAAGGGCATGTGCTACTTCACCAACGGGACAGAGCGCGTGCGTCTTGTGAGCAGAAGCATCTATAACCGAGAAGA
GATCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGCTGCTGGGGCTGCCTGCCGCCGAGTACTGGAACA
GCCAGAAGGACATCCTGGAGAGGAAACGGGCGGCGGTGGACAGGGTGTGCAGACACAACTACCAGTTGGAGCTCCGCACG
ACCTTGCAGCGGCGAGGTGAGCGGCGTCGCCCCTCTGCGAGGCCCACCCTTGGCCCCAAGTCTCTGCGCCAGGAGGGGCG
AAGGGTCGTTGCCTCTGGAACCTGAGCCCCGTTTGTTCCACCCCAGAGGACAGGAGGCAGCGGCGAGAGTGGTGGGGGCA
GGTGCATCGGAGGTGCGGGGACCTAGGGCAGAGCAGGGGGACAGGCAGAGTTGGCCAGGCTGCCTAGTGTCGCCCCAGCC
TACCCGTTCGTCGGCCTTGTCCTCTGCTCTGCATGTTCTTGCCTCGTGCCTTATGCATTTGCCTCCTTTTGCCTTACCTT
TGCTAAGCAGCTCTCTCTGCTCAGAATGCCCGCCCTCTTCCCCTGCCCGCCCGCCCGCCCCGCTAGCACTGCCCCACCCA
GCAAGGCCCACGTGCACAGCTCTTGCAGCAGGAAGCTTCAGGCTTAGCCTGGTGGAGTTAGGGCTGTTCCACAACTGCGC
GCAGGACATCCAGCAATTACAGTTGTGAAATAAGATATTTTAACTTTTGGCTTCAAATCATTATTCATCGTAATTCTGTT
TTCTTAAATGGCTCTCATTCATGGCAGAGATCTTTGAGGTGAGGGTGTTTTAATCATTGCATGCCTAGTACCTGACACAT
TGACTGGTATGTGGTGTGAGCTCAATGATCTTCTGTTAAATTAATGAATAAATGTACTCAGCTGCCCATCCACTTAGGCT
CAAGAAAAAAAAAGAGGTAAACAGAGCCTTAAAAATGGACTTTATTAATTATTTTCTATAATTTTGCTTAATGCTTTAAA
GTAAACTCTTATTGACTTGGATCTTAATAGAGTTTGTGAATACAAAATCTGAGGAAAAAAGTTTTTGCTAAAAATAAAAA
CAACGCTTGAAAGATATTGTAATGCAGTTTAAATTTCTTTTCTTTTTTTTTTTTTTTTTTGAGACGGATTCTCACTCTGT
CGCCCAGGCCGGAGTGCAGTGGCGCGATCTCGGCTCACTGCAAGCTCCGCCTCCCGGGTTCACGCCATTCTCCTGCCTCA
GCCTCCTGAGTAGGTGGGATTACAGGCGCGTGCCACCACGCCCGGCTAATTTTTTTGTATTTTTAGTAGAGGCGGGGTTT
CACCGTGTTAGCCAGGATGGTCTGGATCTCCTGACCTCATGATCCGCCCGCCTCGGCCTCCCAAAGTGCTGGGATTACAG
GTGTGAGCCACAGTGCCCGGCCGGCACTTTTAATTTCTTAGAAAAGCTGAACAAATGGCACAATGCAAAGAGCAAAAGTT
TTGGAATAAATAGATTGAAGCCATTAAATTATTGGATAAAAATAGTTTCGGGTTGCTTTTGGCCTAGGTTCTCCCCTCCC
CCCATGACTATCCACTTCAGGAATAAACATTCTGAAAGTCAATTTTACCCATTTAGTGAGCATTTATTTCTAGACAGTTG
CCTTATCAAATACCATCTATGTTACGTCATTTAATCTCACAGTTACTTGTGCATCAGAGATTAGCATCACCACTTTATAT
ATTGGTACATGATAAACACTTTATTGGTCATGGATGGGGAGATGGTCACTGTAGGCTAATATTGGTACATGATAAACACT
TTAAGTAATCAGCCCATAATTGCTCACCAAGACCTTAAGCCTCCCAAAGTACACAACATTCTTTGTGTTCTTCACTACAC
ATCCATAGAGTCTAAGGGACGTAAAGCCTCGTTAAAGCCAGTTTTGACCAGAAGCAGCAATGAGTCTATTCCTGTGTGTT
TTCCATGTTAATGGGACAAAATGATACTTTCAAGGCATTGAAAATTCATGATTAATCAATCGCTAGTCTGACCCCAGTGT
TATCTATGCAGGTTTGCAAAACCTTTAGTTTACTTAATACTCCCTTGCCTTCTTTTGATTCACATCCTAATGCCAGCAAA
TACTTATGTTTTTGCTATTTCAGTTCCATTTCCATAAAATTTATTTTATCATCTTTTCTCATAAATTTATGCCCTCTATT
TTTACTCCCAATCTGTTTAAGATGAACAAATCTTATAAGGCCACATAGCTGACTGTTATTTCTGTTGGACTCCAGGAAGG
AGAACCTAAAGAAAAGTTCAAGTCCAAGCAGAAACCGTGATTTCTTCCAGATGATGGCTCATGAGTGCCATTTAATTGGG
GTGCCACCTGGTGACCTCAGCAAATCCCAGCTATATTTATGTGTTCACATTACAGGATCATTAACCCAGACCGACCACTG
CACAGATCTCAGAATATTTTCTATGGAGAACATACATAATAATGCCTGATTTCAGAAGAAGAAAGTAATTCTCAATAGCA
AGGGGATGGAGTAGGGTAGACAGCTGTAATTAAACTCACTTGTGTGATAAAAAGAAATTAAGGAAAAAAGAAAATGAGAG
AACATATTACTAAATAAAGAAAGCATACATTAAATATTTACTATAGTTTCACACTAAGAGAATAAAGGAAATGCAATAAA
GTGGCCTGAAAGGTAAAGGATGAGATGTGTAAAGGGGTGTAGTATTTTTACTATGAGCAGCAATCTGAGAAGATAAAGGA
ATCGAGTTACGGGCAAACATGATGTTTGATCAGTGTTATTTGTTTTCAAGGCCTGCCTAAATTTTTTTCAAATATTACAA
ACTTTTGAAATAACATTCTTTTTGTTTTTTGCTGTCTGTTACTAGGTTGCACATTTTATAAAGGCAGGGACCATGGTATG
TTGTTTGTCTTTGGATTCTCAGTGATTGTTATATTTATATTTGTTGAAGGAACCTTAATCCAAGACTTGGACTCCAAGTA
TCTTTCCACTCTGGTTCCAAGGAGGGACCTTCCTCACAGCAGGCATGCTGTGTGGTCTCACATCTCACTCCTATATCTTT
CCCTGTCTGTTACTGCCCTCAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCACCACAACCT
GCTGGTCTGCTCGGTGACAGATTTCTATCCAGCCCAGATCAAAGTCCGGTGGTTTCGGAATGGCCAGGAGGAGACAGCTG
GCGTTGTGTCCACCCCCCTTATTAGGAATGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACTCCCCAGCGT
GGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGCCCCATCACCGTGGAGTGGCGTAAGGGGATATTGAG
TTTCTGTTACTGTGGGCCCCACAAGACAAAGGACAGAGCTCCTTCTGACCCATCCCTTCCCATCTCTTATCCCTGATGTC
ACTGCTGAGCTGGGAATCACAGGAGACTAGAGCACCTCTAGTTCCATGGCGAGTGCATCAGAAGAATCCTGATCTCATCA
CCTTTCCAGATGCTAGGGAAATTACTCTACATACTGTTGCTCTGGATCCCAGTCCTGATTGCTCTGAGGAACTGATTATT
AGGGCTGGTGACTGGGATCTTAGGGTCTAAGTTTATGGATGAGTTCCTGAGGAGTGGAGATCTGCTTCCCCACTCTGTCA
CCTACTCACTGTATCCAAGTACCTATTGGCTGGCCTTTCCCTCCCTTAGGGGTGGTCTGAATGGAGAACTAGGTTCCTTT
GATGCCTTCACCTCCTGCATCTCAGACTGGACTTCAGCTCCTCATCAGGGAAACTATGGGGTATGGGGACAAACACTGAC
ACTCAGGCTCTGCTTCTCAGGGGCTCAATCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCATTGGAGGCTTCGTGCTGG
GGCTGATCTTCCTCGGGCTGGGCCTTATCATCCATCACAGGAGTCAGAAAGGTGAGGAACCCCAGGGGAAAAGGGGAAGA
TGGCCTGTGACCCAGACCCTCTGTTCAGAGAGGTCCTGTCTCTAGATGTAGCTCTTTCCTCCTGACCCTGAGAGGAAGAA
AGCTGAGCTGGAAGTGGAAGGAGACAGGACAAGGTTGGAGGAGGCATTGGAATCTGATTTTACTAGCTGAAGGGTAGCCC
TGTCACAGAGCTGACTGATAGAGCTTATTCCAGGGCATCCTTACCATTCATCATTGTCTCACTGGCTCCTTTCCAAAAAC
TTCCTCCATTAAGAGGGTCAGAGCCTCGGCCTCCTTGCCTTCTAGTGACAATTTCCTTTATTTTAGGGGATTTTAAATTA
GGGTGCTTAAGGACTTGAAGAACATGAATGGGAAGAGAATATAACTCTAATTAAGTCACATGTGTCATTTTCCTTTGGGG
TGAGAGAGTGGCTGTTCATGTAATGAGACCTTTCTCTGCATAACTTCCTTTTGTAAGACCTCAAGGGCCTCCACCAGCAG
GTAATATTTCAGCCGTGATCCAGTGTGGGGAGGGCACAGGTGTAAGAGGGAAGAGCATGAGCTGAGTGTACCTGACAGTA
GTGGTCTCTGTTCATGGTATATTTGCTGCTATGAGGATCAAGACTTAGGGGTGAAGTTTGCCAGTTTCTAGGAATCTCCA
GAGGTTGTTCCCCAGAACCAAGCCTTAACTTTGGTGGTATCTTCCTGTGAAATGTGGAGCCAGAACCACGGCTTAAATGT
TAGACACTAGGATGATGCCCACTTTGTGCCACATGATGGTGGCTACTGCCTGTAGGCATTTTCCAGTGACTGAAAGAGGC
TGCTAGTGGTAGGGATGAGGTATCATCCAATTTCCTAAAAAGATTGAACCCTTCATATTCACCAGAAGAGTAACAGCTGT
TCCCCCACCTCCCACACATCTGCATCAAGCTGAAGTTCTGTGTCTTCATGAGCTGATTTCACCTTTGCACAGATCTTGGG
GGAGGTGATGATAATACACTCTGGACCTCAGCTTTGTCTGTCTGAAGCTGCAGGAGGCCCCTGAGGGGTGGGGGAGATGG
CAGGCCCACCAGCGTACCCTGTGCTGATCATCCCTCTTCTCTCTTCTTCAGGGCTCCTGCACTGACTCCTGAGACTATTT
TAACTGGGATTGGTTATCACTTTTCTGTAACGCCTGCTTGTCCCTGCCCAGAATTCCCAGCTGTCTGTGTCAGCCTGTCC
CCCTGAGATCAGAGTCCTACAGTGGCTGTCACGCAGCCACCAGGTCATCTCCTTTCATCCCCACCTTGAGGCGGATGGCT
GTGACCCTACTTCCTGCACTGACCCACAGCC

IMGT/HLA

Sponsors

Animated Sponsors Logo