Allele Report for DQB1*02:01:02

DQB1*02:01:02 View HGVS Report
Pre-2010 Nomenclature: DQB1*020102 Local Names: HLA-DQB1
IMGT/HLA Acc No: HLA01934 OMIM Entry: *604305
Assigned: 2004-05-20 Sequence Last Modified: 2004-07-08
Source Entries: AY619719  
Cells Sequence Derived From: NW165  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Lv F et al. Tissue Antigens 64:619-20 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: DQ2 WHO Assigned Type: DQ2
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 30 DQ2 [87-100%]
NMDP (2008) 9175 DQ2 [98%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DQ2
Comments:
Protein Sequence (89 aa)
DFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQL
ELRTTLQRR
Nucleotide Sequence Data (270 bps)
AGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACAGAGCGCGTGCGTCTTGTGAGCAGAAGCATC
TATAACCGAGAAGAGATCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGCTGCTGGGGCTGCCTGCCGC
CGAGTATTGGAACAGCCAGAAGGACATCCTGGAGAGGAAACGGGCGGCGGTGGACAGGGTGTGCAGACACAACTACCAGT
TGGAGCTCCGCACGACCTTGCAGCGGCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo