Allele Report for DQB1*02:01:01

DQB1*02:01:01 View HGVS Report
Pre-2010 Nomenclature: DQB1*020101 Local Names: DQB 2 (DQB3), DQB 2, DQw2, VAVY-2.3,
IMGT/HLA Acc No: HLA00622 OMIM Entry: *604305
Assigned: 1989-08-01 Sequence Last Modified: 1999-08-06
Source Entries: AL731683 , AL935026 , AY663399 , AY663407 , K02405 , L40179 , M65043 , M81140  
Cells Sequence Derived From: BEI , CMCC , DM24 , DM28 , DM29 , JNP , LD , MOR , MZ , NA01018 , NA10923 , QBL , VAVY , VW , WT49  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Common
Publications
Horn GT et al. Proc Natl Acad Sci U S A 85:6012-6 1988. (View abstract)
Raymond CK et al. Genome Res 15:1250-7 2005. (View abstract)
Todd JA et al. Nature 329:599-604 1987. (View abstract)
Horn GT et al. Hum Immunol 21:249-63 1988. (View abstract)
Hall MA et al. Hum Immunol 38:284-92 1993. (View abstract)
Yasunaga S et al. Tissue Antigens 47:37-48 1996. (View abstract)
Boss JM et al. Proc Natl Acad Sci U S A 81:5199-203 1984. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 15 Laboratories: 7
HLA Dictionary Data
Expert Assigned Type: DQ2 WHO Assigned Type: DQ2
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 30 DQ2 [87-100%]
NMDP (2008) 9175 DQ2 [98%]
13 IHWC (2002) Not tested Not tested
Neural Network Assigned Type: Training - DQ2
Comments:
Protein Sequence (261 aa)
MSWKKALRIPGGLRAATVTLMLSMLSTPVAEGRDSPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFR
AVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPAQIK
VRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGIGGFVL
GLIFLGLGLIIHHRSQKGLLH
Nucleotide Sequence Data (786 bps)
ATGTCTTGGAAAAAGGCTTTGCGGATCCCCGGAGGCCTTCGGGCAGCAACTGTGACCTTGATGCTGTCGATGCTGAGCAC
CCCAGTGGCTGAGGGCAGAGACTCTCCCGAGGATTTCGTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACAG
AGCGCGTGCGTCTTGTGAGCAGAAGCATCTATAACCGAGAAGAGATCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGG
GCGGTGACGCTGCTGGGGCTGCCTGCCGCCGAGTACTGGAACAGCCAGAAGGACATCCTGGAGAGGAAACGGGCGGCGGT
GGACAGGGTGTGCAGACACAACTACCAGTTGGAGCTCCGCACGACCTTGCAGCGGCGAGTGGAGCCCACAGTGACCATCT
CCCCATCCAGGACAGAGGCCCTCAACCACCACAACCTGCTGGTCTGCTCGGTGACAGATTTCTATCCAGCCCAGATCAAA
GTCCGGTGGTTTCGGAATGACCAGGAGGAGACAGCTGGCGTTGTGTCCACCCCCCTTATTAGGAATGGTGACTGGACCTT
CCAGATCCTGGTGATGCTGGAAATGACTCCCCAGCGTGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGA
GCCCCATCACCGTGGAGTGGCGGGCTCAATCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCATTGGAGGCTTCGTGCTG
GGGCTGATCTTCCTCGGGCTGGGCCTTATCATCCATCACAGGAGTCAGAAAGGGCTCCTGCACTGA
Genomic Sequence Data (7480 bps)
TTCTAAGAACTTTGCTCTTTTCACCAAAACTTAAGGCTCCTCAGGGTGTGTCTAAGACAACAGCAGTAAAAATGTCTATG
ACAGCAATTTTCTCTCCCCTGAAATATGATCCCCACTTAATTTGCCCTATTGAAAGAATCCCAAGTATAAGAACAACTGG
TTTTTAATCAATATTACAAAGATGTTTACTGTTGAATCGCATTTTTCTTTGGCTTCTTAAAATCCCTTAGGCATTCAATC
TTCAGCTCTTCCATAATTGAGAGGAAATTTTCACCTCAAATGTTCATCCAGTGCAATTGAAAGACGTCACAGTGCCAGGC
ACTGGATTCAGAACCTTCACAAAAAAAAAATCTGCCCAGAGACAGATGAGGTCCTTCAGCTCCAGTGCTGATTGGTTCCT
TTCCAAGGGACCATCCAATCCTACCACGCATGGAAACATCCACAGATTTTTATTCTTTCTGCCAGGTACATCAGATCCAT
CAGGTCCGAGCTGTGTTGACTACCACTTTTCCCTTCGTCTCAATTATGTCTTGGAAAAAGGCTTTGCGGATCCCCGGAGG
CCTTCGGGCAGCAACTGTGACCTTGATGCTGTCGATGCTGAGCACCCCAGTGGCTGAGGGCAGAGACTCTCCCGGTAAGT
GCAGGGCAGCTGCTCTCCAGAGCCGCTACTCTGGGAACAGGCTCTCCTTGGGCTGGGGTACGGGGATGGTGATCTCCATA
ATCTCGGACACAATCTTTTATCAACATTTCCTCTGTTTTGGGAAAGAGAGCTATGTTGCATTTCCATTTATCTTTTAATG
ATGAAGTGAGGACAATCCAATCCCATCCTACAGGCTTAAGCCTGGAAGAGGAGGAGAGAGGAGAGAAAAGAGGAGACAAA
GTGTTCATTTACTACCAGTGATAGGACAAAGTGAGCATGGGGTTATTTTTGAAGATATGAATTTCTCCAAAGACACAGCA
GGATTTGCCATTTAGGCGTGTCCCAAGACTTGCCTGGACTAAATATTATGATTTCCTGCATTGGGAAATGCAAGGCAGCA
ATGGTGTCTGTAGTCTCCGTATTTGGGGAAAAGTTGTCTGTATTCCTGACCCAGTGGAGCGTTTGTGGAGGCAAAATCTT
GGTACTGAGGGAAGCTGACTGGCTGACCACAGAAAGAGAGCCTTCAGGTTTCACTGATTTATGGGCAAATGGTGACCTGA
GTGGGATTCAGATACCCGAGTTGATGATGGACTAAATTTAGTAGAAAGGAGGATGTAAAGAAGGGAAATAACACATACTG
TGAAACCACTCATTTCAGACACAGAACAATACTTTACATAAATTCTCTCTCACTCCTTCTAACATCCTGTGTGTAGATAT
CATGATTTTCTTTTACACAATTATACTTGTGATATGGATATTCTGTTACATAAACTGCCCGGGCTGGTGACTGCCACAGT
TTAATGGGAATCTAGTTTATCAAATTCAAAAGCTTGTGCTCTTTCGGTGAATAAATGTTTCTTTCTAGGACTCAGAGATC
TAGGACTCCCTTCTTTCTAACACAGACGTGAGTGAACCTCACAGGGCACTTGGGAGGGTAAATCCAGGCATGGGAAGGAA
GGTATTTTACCCAGGGACCAAGAGAATAGGCGTATCGGAAGAGGACAGGTTTAATTCCTGGACCTGTCTCGTCATTCCCT
TGAACTGTCAGGTTTATGTGGATAACTTTATCTCTGAGGTACCCAGGAGCTCCATGGAAAATGAGATTTCATGCGAGAAC
GCCCTGATCCCTCTAAGTGCAGAGGTCCATGTAAAATCAGCCCGACTGCCTCTTCACTTGGTTCACAGGCCGAGACAGGG
ACAGGGCTTTCCTCCCTTTCCTGCCTGTAGGAAGGCGGATTCCCGAAGACCCCCGAGAGGGCGGGCAGGGCTGGGCAGAG
CCGCCGGGAGGATCCCAGGTCTGCAGCGCGAGGCACGGGCCGGCGGGAACTTGTGGTCGCGCGGGCTGTTCCACAGCTCC
GGGCCGGGTCAGGGTGGCGGCTGCGGGGGCGGACGGGCTGGGCCGCACTGACTGGCCGGTGATTCCTCGCAGAGGATTTC
GTGTACCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACAGAGCGCGTGCGTCTTGTGAGCAGAAGCATCTATAACCG
AGAAGAGATCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGCTGCTGGGGCTGCCTGCCGCCGAGTACT
GGAACAGCCAGAAGGACATCCTGGAGAGGAAACGGGCGGCGGTGGACAGGGTGTGCAGACACAACTACCAGTTGGAGCTC
CGCACGACCTTGCAGCGGCGAGGTGAGCGGCGTCGCCCCTCTGCGAGGCCCACCCTTGGCCCCAAGTCTCTGCGCCAGGA
GGGGCGAAGGGTCGTGGCCTCTGGAACCTGAGCCCCGTTTGTTCCACCCCAGAGGACAGGAGGCAGCGGCGAGAGTGGTG
GGGGCAGGTGCATCGGAGGTGCGGGGACCTAGGGCAGAGCAGGGGGACAGGCAGAGTTGGCCAGGCTGCCTAGTGTCGCC
CCAGCCTACCCGTTCGTCGGCCTTGTCCTCTGCTCTGCATGTTCTTGCCTCGTGCCTTATGCATTTGCCTCCTTTTGCCT
TACCTTTGCTAAGCAGCTCTCTCTGCTCAGAATGCCCGCCCTCTTCCCCTGCCCGCCCGCCCGCCCCACTAGCACTGCCC
CACCCAGCAAGGCCCACGTGCACAGCTCTTGCAGCAGGAAGCTTCAGGCTTAGCCTGGTGGAGTTAGGGCTGTTCCACAA
CTGCGCGCAGGACATTCAGCAATTACAGTTGTGAAATAAGATATTTTAACTTTTGGCTTCAAATCATTATTCATCGTAAT
TCTGTTTTCTTAAATGGCTCTCATTCATGGCAGAGATCTTTGAGGTGAGGGTGTTTTAATCATTGCATGCCTAGTACCTG
ACACATTGACTGGTATGTGGTGTGAGCTCAATGATCTTCTGTTAAATTAATGAATAAATGTACTCAGCTGCCCATCCACT
TAGGCTCAAGAAAAAAAAAGAGGTAAACAGAGCCTTAAAAATGGACTTTATTAATTATTTTCTATAATTTTGCTTAATGC
TTTAAAGTAAACTCTTATTGACTTGGATCTTAATAGAGTTTGTGAATACAAAATCTGAGGAAAAAAGTTTTTGCTAAAAA
TAAAAACAACGCTTGAAAGATATTGTAAGGCAGTTTAAATTTCTTTTCTTTTCTTTTTTTTTTTTTTTTGAGACGGATTC
TCACTCTGTCGCCCAGGCCGGAGTGCAGTGGCGCGATCTCGGCTCACTGCAAGCTCCGCCTCCCGGGTTCACGCCATTCT
CCTGCCTCAGCCTCCTGAGTAGGTGGGATTACAGGCGCGTGCCACCACGCCCGGCTAATTTTTTTGTATTTTTAGTAGAG
GCGGGGTTTCACCGTGTTAGCCAGGATGGTCTGGATCTCCTGACCTCATGATCCGCCCGCCTCGGCCTCCCAAAGTGCTG
GGATTACAGGTGTGAGCCACAGTGCCCGGCCGGCACTTTTAATTTCTTAGAAAAGCTGAACAAATGGCACAATGCAAAGA
GCAAAAGTTTTGGAATAAATAGATTGAAGCCATTAAATTATTGGATAAAAATAGTTTCGGGTTGCTTTTGGCCTAGGTTC
TCCCCTCCCCCCATGACTATCCACTTCAGGAATAAACATTCTGAAAGTCAATTTTACCCATTTAGTGAGCATTTATTTCT
AGACAGTTGCCTTATCAAATACCATCTATGTTACGTCATTTAATCTCACAGTTACTTGTGCATCAGAGATTAGCATCACC
ACTTTATATATTGGTACATGATAAACACTTTATTGGTCATGGATGGGGAGATGGTCACTGTAGGCTAATATTGGTACATG
ATAAACACTTTAAGTAATCAGCCCATAATTGCTCACCAAGACCTTAAGCCTCCCAAAGTACACAACATTCTTTGTGTTCT
TCACTACACATCCATAGAGTCTAAGGGACGTAAAGCCTCGTTAAAGCCAGTTTTGACCAGAAGCAGCAATGAGTCTATTC
CTGTGTGTTTTCCATGTTAATGGGACAAAATGATACTTTCAAGGCATTGAAAATTCATGATTAATCAATCCCTAGTCTGA
CCCCAGTGTTATCTATGCAGGTTTGCAAAACCTTTAGTTTACTTAATACTCCCTTGCCTTCTTTTGATTCACATCCTAAT
GCCAGCAAATACTTATGTTTTTGCTATTTCAGTTCCATTTCCATAAAATTTATTTTATCATCTTTTCTCATAAATTTATG
CCCTCTATTTTTACTCCCAATCTGTTTAAGATGAACAAATCTTATAAGGCCACATAGCTGACTGTTATTTCTGTTGGACT
CCAGGAAGGAGAACCTAAAGAAAAGTTCAAGTCCAAGCAGAAACCGTGATTTCTTCCAGATGATGGCTCATGAGTGCCAT
TTAATTGGGGTGCCACCTGGTGACCTCAGCAAATCCCAGCTATATTTATGTGTTCACATTACAGGATCATTAACCCAGAC
CGACCACTGCACAGATCTCAGAATATTTTCTATGGAGAACATACATAATAATGCCTGATTTCAGAAGAAGAAAGTAATTC
TCAATAGCAAGGGGATGGAGTAGGGTAGACAGCTGTAATTAAACTCACTTGTGTGATAAAAAGAAATTAAGGAAAAAAGA
AAATGAGAGAACATATTACTAAATAAAGAAAGCATACATTAAATATTTACTATAGTTTCACACTAAGAGAATAAAGGAAA
TGCAATAAAGTGGCCTGAAAGGTAAAGGATGAGATGTGTAAAGGGGTGTAGTATTTTTACTATGAGCAGCAATCTGAGAA
GATAAAGGAATCGAGTTACGGGCAAACATGATGTTTGATCAGTGTTATTTGTTTTCAAGGCCTGCCTAAATTTTTTTCAA
ATATTACAAACTTTTGAAATAACATTCTTTTTGTTTTTTGCTGTCTGTTACTAGGTTGCACATTTTATAAAGGCAGGGAC
CATGGTATGTTGTTTGTCTTTGGATTCTCAGTGATTGTTATATTTATATTTGTTGAAGGAACCTTAATCCAAGACTTGGA
CTCCAAGTATCTTTCCACTCTGGTTCCAAGGAGGGACCTTCCTCACAGCAGGCATGCTGTGTGGTCTCACATCTCACTCC
TATATCTTTCCCTGTCTGTTACTGCCCTCAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCA
CCACAACCTGCTGGTCTGCTCGGTGACAGATTTCTATCCAGCCCAGATCAAAGTCCGGTGGTTTCGGAATGACCAGGAGG
AGACAGCTGGCGTTGTGTCCACCCCCCTTATTAGGAATGGTGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACT
CCCCAGCGTGGAGACGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGCCCCATCACCGTGGAGTGGCGTAAGGG
GATATTGAGTTTCTGTTACTGTGGGCCCCACAAGACAAAGGACAGAGCTCCTTCTGACCCATCCCTTCCCATCTCTTATC
CCTGATGTCACTGCTGAGCTGGGAATCACAGGAGACTAGAGCACCTCTAGTTCCATGGCGAGTGCATCAGAAGAATCCTG
ATCTCATCACCTTTCCAGATGCTAGGGAAATTACTCTACATACTGTTGCTCTGGATCCCAGTCCTGATTGCTCTGAGGAA
CTGATTATTAGGGCTGGTGACTGGGATCTTAGGGTCTAAGTTTATGGATGAGTTCCTGAGGAGTGGAGATCTGCTTCCCC
ACTCTGTCACCTACTCACTGTATCCAAGGACCTATTGGCTGGCCTTTCCCTCCCTTAGGGGTGGTCTGAATGGAGAACTA
GGTTCCTTTGATGCCTTCACCTCCTGCATCTCAGACTGGACTTCAGCTCCTCATCAGGGAAACTATGGGGTATGGGGACA
AACACTGACACTCAGGCTCTGCTTCTCAGGGGCTCAATCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCATTGGAGGCT
TCGTGCTGGGGCTGATCTTCCTCGGGCTGGGCCTTATCATCCATCACAGGAGTCAGAAAGGTGAGGAACCCCAGGGGAAA
AGGGGAAGATGGCCTGTGACCCAGACCCTCTGTTCAGAGAGGTCCTGTCTCTAGATGTAGCTCTTTCCTCCTGACCCTGA
GAGGAAGAAAGCTGAGCTGGAAGTGGAAGGAGACAGGACAAGGTTGGAGGAGGCATTGGAATCTGATTTTACTAGCTGAA
GGGTAGCCCTGTCACAGAGCTGACTGATAGAGCTTATTCCAGGGCATCCTTACCATTCATCATTGTCTCACTGGCTCCTT
TCCAAAAACTTCCTCCATTAAGAGGGTCAGAGCCTCGGCCTCCTTGCCTTCTAGTGACAATTTCCTTTATTTTAGGGGAT
TTTAAATTAGGGTGCTTAAGGACTTGAAGAACATGAATGGGAAGAGAATATAACTCTAATTAAGTCACATGTGTCATTTT
CCTTTGGGGTGAGAGAGTGGCTGTTCATGTAATGAGACCTTTCTCTGCATAACTTCCTTTTGTAAGACCTCAAGGGCCTC
CACCAGCAGGTAATATTTCAGCCGTGATCCAGTGTGGGGAGGGCACAGGTGTAAGAGGGAAGAGCATGAGCTGAGTGTAC
CTGACAGTAGTGGTCTCTGTTCATGGTATATTTGCTGCTATGAGGATCAAGACTTAGGGGTGAAGTTTGCCAGTTTCTAG
GAATCTCCAGAGGTTGTTCCCCAGAACCAAGCCTTAACTTTGGTGGTATCTTCCTGTTAAATGTGGAGCCAGAACCACGG
CTTAAATGTTAGACACTAGGATGATGCCCACTTTGTGCCACATGATGGTGGCTACTGCCTGTAGGCATTTTCCAGTGACT
GAAAGAGGCTGCTAGTGGTAGGGATGAGGTATCATCCAATTTCCTAAAAAGATTGAACCCTTCATATTCACCAGAAGAGT
AACAGCTGTTCCCCCACCTCCCACACATCTGCATCAAGCTGAAGTTCTGTGTCTTCATGAGCTGATTTCACCTTTGCACA
GATCTTGGGGGAGGTGATGACAATACACTCTGGACCTCAGCTTTGTCTGTCTGAAGCTGCAGGAGGCCCCTGAGGGGTGG
GGAAGATGGCAGGCCCACCAGCGTACCCTGTGCTGATCATCCCTCTTCTCTCTTCTTCAGGGCTCCTGCACTGACTCCTG
AGACTATTTTAACTGGGATTGGTTATCACTTTTCTGTAACGCCTGCTTGTCCCTGCCCAGAATTCCCAGCTGTCTGTGTC
AGCCTGTCCCCCTGAGATCAGAGTCCTACAGTGGCTGTCACGCAGCCACCAGGTCATCTCCTTTCATCCCCACCTTGAGG
CGGATGGCTGTGACCCTACTTCCTGCACTGACCCACAGCC

IMGT/HLA

Sponsors

Animated Sponsors Logo