Allele Report for DQA1*05:05:01:03

DQA1*05:05:01:03 View HGVS Report
Pre-2010 Nomenclature: Local Names: DQA1*05:05:01:03
IMGT/HLA Acc No: HLA06609 OMIM Entry: *146880
Assigned: 2011-02-28 Sequence Last Modified: 2011-04-08
Source Entries: AY663409  
Cells Sequence Derived From: NA04535  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Raymond CK et al. Genome Res 15:1250-7 2005. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (254 aa)
MILNKALMLGTLALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFD
PQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSET
SFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIR
GLRSVGASRHQGPL
Nucleotide Sequence Data (765 bps)
ATGATCCTAAACAAAGCTCTGATGCTGGGGACCCTTGCCCTGACCACCGTGATGAGCCCCTGTGGAGGTGAAGACATTGT
GGCTGACCACGTCGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGATG
GAGATGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGACAATTTAGATTTGAC
CCGCAATTTGCACTGACAAACATCGCTGTCCTAAAACATAACTTGAACAGTCTGATTAAACGCTCCAACTCTACCGCTGC
TACCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACATCCTCATCTGTCTTG
TGGACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACC
AGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCCTCCTCCCTTCTGCTGAGGAGAGTTATGA
CTGCAAGGTGGAGCACTGGGGACTGGACAAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCCCCTATGTCAGAGC
TCACAGAGACTGTGGTCTGCGCCCTGGGGTTGTCTGTGGGCCTCGTGGGCATTGTGGTGGGCACTGTCTTCATCATCCGA
GGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTGTGA
Genomic Sequence Data (6393 bps)
AAAAATTCCTGGAGGTTGTAACTCAGAAAATCCTGAAGGATGCCGTAGAATTGATGACATCATCTATCCACGAGGCTGCT
CAGAAATGCCCACCCCTGGCCAGGGCGGTGGCTCATGCCTGTAATCTGAGCACTTTGGGAGGCTGAGATGGGCAGATCAC
GAATTCAGGAGTTCGAGACCAGCCTGGCCAACATAGTGAAACTCTGTCTCTACTAAAAATACAAAAATTAGCCGGGCGTG
GTGGCAGGCGCCTGTAATCCCAGCTACTTGGGAGGGTGAGACAGGAGAATCACTTGAACCCGGGAGTCAAAGTTTGCAGT
GAGCCGAGACCATGCCATTGCACCTCAGCCTGGGTGACAGAGTGAGACTACATCTCAAAAAAAAAAAAAAAAAAGAAAGA
AAAAAAAGAAAAGAAATGCCCACCCCTCTTGCCACTGGCAGACATGCACACACCAGAGAAGATTCCGATTTCGTGTCCTC
CCTCTATTCACAGAACATTTCCTCAAGTCCACTCTGAGTGGAGGCTGCATCACAACAAGGGGATTGCCCTGTCTCCTTCC
AGGGCTCTTAATACAAACTCTTCAACTAGTAACTGAGGTGTCATCATAGGGGATTTTTCTAATTAGCCAAAACCTGACTT
GGCAGGGTTTGGTTTGGGTGTCTTCAGATTGCCTTGTCTCGAGGTCCTCACAATTGCTCTACAACTCAGAACAGCAACTG
CTAAGGCTGCCTTGGGAAGAGGATGATCCTAAACAAAGCTCTGATGCTGGGGACCCTTGCCCTGACCACCGTGATGAGCC
CCTGTGGAGGTGAAGACATTGTGGGTGAGTGTATGAGTGAGGGATGTTCTCTGGAGCTGGAAGAGAGGAAATTGAAGCAA
AAGAGAGAAAGCGATTTGCAGAGAAATTGTAGAGATTTCCTAAGGGTCCCTTCAGTATTAAGAGATTTAAAAATTATGGC
TGTTCCTCCTTCAGGAAACCAGAGTCCCAACCTACTCTTTTTGTTATCTATGCTGTTGGCGTTCACTAAGGATGCTATTC
TGTTTATATTGTATTCAGTGACTATAGCCTGGAGGTCTCTATGTCATTCCATCATGATTGCCTCAAAAATTAGTGAGGTT
TCCATCAATGGATAATTTTTTATTATTAAAAATTTGTGAAGTATCATTCTCAAATTTCCCTGAACAACTTTTGAAGCTTT
TCGGATGTCTCCTGTAGTAGCGCTTGGGGTAAATGATTCCATCAATTATATACTCTATAGATATTAAGAAAGATGCCCTT
TTCTTTCTCTCAGACTTACTAACATTTCCACGTGGGAACTGGCACAGGTGGGGAGTGGGTAAAGGAGTCCAGCAGGCTGA
ATGCCTTCAACAATCATTTTACCACATGGTCCTCACTTACTCTCAGCTGCCTCATATGTGTCACCTCACAAATAATCAAA
TAAAATGGGCATGTAGCTAAGCTTTGTAAATAGTGAAAACATGAATGTCAATTTTATTTTTACATATTTCTATTATAGGT
ATAGCTTCACATTTCTTTTCTTTTGCAAAATAAGGAATCCTTTTATTTTAAAATTGAGAATTTATAGTAGAAAAACTTGG
TAAATTAAATCATTTTATTCTCAAATTATCAACCCAAATTACCTGTTCTTCAACTCATCTAATGAAGTCCTATAAAAAGA
AAAGTGGGCCAGACATGGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCGAGGCAGGAGGATCCTTTGAGCCCAG
GAGTTGAGACCAGCCTGGGCAACATAGCAAGACCTCATCTCTACAAAAAATAAAAATTAGCCAGGTGTGGTGGTGCATGC
CTGTGGTGCCAGCTACTCAGAAGGCTGCAGTGGGAGGACTGCTTGAGTCCAGGAGGCGGAAGCTGCAGTGAGCCATGATG
GCACCACTACACTCCAGCCAGGGCAACAGAGAGAAACTCTGTCTCAGAAAGAAAAAGGAAAGAAAGAGAGAAAGGAAGGA
AAGAAAGAAAGAAGGAAGGAAGGAAGGAAGAAGGGGAAGGGAAGGGAAGGAAGGGAAGGAAAGGGAAGGGAGGAAAGAAG
GAAGGAAAAAAGAAAAAGAAAGAAAAAAGAAAGAAAAAGAAAGAAAGAAAGAAAAGAGGGAAGGAAAGAAAGAAAAAGGA
AGGAAGGAAGCACAGATTAATTATTAATCATTTGGTCTCTCTTAGTCTTCTCTGTCTTTGTCATCCATCTATTTCCACCT
CTCTTCATGCATTCCTTTCTCCCTCTTCCCTTTCAGGATCCATCTCTGACTCCCTGCTTCTTTATATGGACAGTGGGGTT
TGTAAAACAAAAGTTGAAAAATCAGATAGTTAAAAGGTGAAGTGAACTGGAAGGTCTAAACTTCCACAACCTTATTAACC
ATGGCTGCTCCCATTCTGATTTTGTTCGACGGTGGAAGTTTCACCTCCTTCTCCAGAGCACTTGGCTTCTTTGTTCCAAA
TTTCCTTTCTTCAACCTCACACCAGAGTGCCCTGGTCAGGCTCGGCTCATCCATTAGGCACAACATGGGCAATGCAGAGA
ACCCTCCATACTGTAAAGCCACATGAGAATGTTTTAACTCCTTTTAAGATTAGAAAAAAATGAAATTTCAGAGCCTAAGA
AAATGTTTTAATTCAGCCTAGATTGTATTGTCTTTATACCAATTCAGTCATAAAATACAATTTTCCATATTTTCATGGAG
GAAGGGGCCCACAAAAGCAAGAGTGCTCAGGGCTCACATGTCAGAATGCAGCCCTGGTCATGGCTGATCCTGGCCTTCTT
ATGATTCTGCTAGTGTGCCTGTCCGTCTTCCCCAAAATCTATGTCGTCCTCAAATATAGCAACTGTAATTCAAAACACGT
TTGAGCACACAGTAAGCTAAGTTTTAAGGATTCAAAGATGAAAAGTCATGCTGTCTTCCCTGCAGAGGGTGCTCAGACTA
GTGATGGAAACGGTATGGGATGCAGGAAAGCAGAAGGCCATTGCTGACCAGGGCAGTGGACTCAGCAGAGGCTGAAACTA
TACAAATGACTTGGTTCCAGCTGGGCCAGCAGGGTGACATCCTCCAGCAAAACTCGGCACCCAAGACAAGTCCCAGATGA
AAAGAAGGATTGCTTTGTGTTTGATAAGGAGTCAAGGTTTATTGCAAGGATAAGGCTTTGTTGGTGGCCTGTTAAGACAA
TCCAGGGCAGTCATACTGGATAAGGAAGAAGGTGAGCTGGAAGAGGAACAGACAAACAGCCAGATATTGAGGTGGAGGAG
CTGGAGGTCATAACGTGGTCAAAAACATGTCGATGAGAGGACTTAGCTACAAAGTTGTTAACTTAAGCAGAAACCTCAAG
GATGAATTTTAGGATTTCTCCAGGAAGTCCTAAAAGATAATTTCATTTCAGGGAGAAAAACAACAAACCACTGGAAAGAC
CAGGGAACATGAAAGGATAATGTAGTTTGGTTTGCTTGGCAGATACTTATGAAGGATGTTGGACTGTAAGGCTGTTGATA
GCCTCCTCACAGAACATGCTACAGTACATTGTATCTGCTCCCTTACCTACCTGACTCTTCCACTCTTCAGTTTGTTCCTT
AATGGTAGACCATGCCTGATTGGTGTTTTACACATCCCCTGCTATGTCTGACACTTGTGGATGCTCAGAAAGTGGGGAAG
GAAGGAAAGATACAACGGTAAAAGGCTTACACGTCTTGACAGGAATGTCCAGTTCGGCTCATTTGGCTGGAGCCACATTG
CACGGCTGCCATTCTGCTCTGGCATCCTCAGACAAGCACACTGCCCATTAGAGGAAAAAGGGTTTAATTTACCTGAGTCC
TCAAGTGAATATAAGTGTTAAGTCAGAACACTGTAGACATTTAGTAACCTCCTTCAGAGGAAAAAAAAAGGTGGGGGGAA
ATGACAGAAATCCAAAAACTAGTAGAGCTTCCACTCTTCATTTCAGAAGAAATCAGTTGCTCTCCTCTAAGGACCATTAC
TATTAACAAAACAGAGACCTTGAAGGAGGCATTGTTTATTTATTATATATTTTGTAATGTTATTACCATTCTTGTTATAC
TATTCCTTATACCCTACAATTGTTAGCAGACATTATTTTAAATTAATAAGATCCTGCATGCTTTTCTTTTTTTAAAAAAA
AGAAAGACCTTCTGTGTAGAGTGTCCTGTTCTGAGCCAGTCCTGAGAGGAAAGAAAATACAATCAGTTTGTTATTAACTG
AGGAAAGAATTAAGTGAAAGATGAATCTTAGGAAGCAGAAGGAAGTAAACCTAATCTCTGACTAAGAAAGCTAAATACCA
TAATAACTCATTCATTCCTTCTTTTGTTCAATTACATTATTTAATCATAAGTCCGTGATGTGCCAGGCACTCAGGAAATA
GTAAAAACTGGACATGTGATATTCTGCCCTTGTGTAGCGCACATTATAGTGGGAAAGAAAGCGCAATTTTAACCGGACAA
CTACCAACAATAAGAGCGGAGGAAGCAGGGGTTGGAAATGTCCACAGGCTGTGCCAAAGATGAAGCCCGTAATATTTGAA
AGTCAGTTTCTTTCATCATTTTGTGTATTAAGGTTCTTTCTTCCCCTGTTCTCCACCTTCCTGCTTGTCATCTTCACTCA
TCAGCTGACCACGTCGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGA
TGGAGATGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGACAATTTAGATTTG
ACCCGCAATTTGCACTGACAAACATCGCTGTCCTAAAACATAACTTGAACAGTCTGATTAAACGCTCCAACTCTACCGCT
GCTACCAATGGTATGTGTCAACAATTCTGCCCCTCTTTACTGATTTATCCCTTCATACCAAGTTTCATTATTTTATTTCC
AAGAGGTCCCCAGATCTTCTCATGGCAATTGCTGAAATTTTATCATCTCCCATCTCTAAAATCACATATTCCCATGTAAT
ACAAGGGTCTTTCCATTATCCATTCATTAAATCCTTCTCGGAGAGGTCTCATCAACCTCCTACTTTATTAAACATGCCCA
CAGAGAGAAGGGCACAGGAATAAAGCGGAGGCAATGTGTCGTTGCTCCCAAGCAGAAGGTAAATAAGACCTCTTTGACTA
TCAGGTGGTGAAATGCTGGTAGGAGGGCTCTTCCAGGATGTAATGCAGAAGCTCATGGCAGAGCTATTCACACTTCACAT
CAGTGCTGTTTCCTCACCACAGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACAT
CCTCATCTGTCTTGTGGACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCACTCAGTCACAGAAG
GTGTTTCTGAGACCAGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCCTCCTCCCTTCTGCT
GAGGAGAGTTATGACTGCAAGGTGGAGCACTGGGGACTGGACAAGCCTCTTCTGAAACACTGGGGTAAGGATGAGTTCCA
CCACTTTTTGATGCTTTCTTGTCTGTCAAGTTCAGAACTTCCTGCCTTTTACTCCTATATCCCAAAACTTGTTTTCCACA
CTTCATGGGTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTTTTG
AAAGAATAAAGCAACAAAAGCAAAGATTTATTGAAAATGAAAGTACACTTCACATGGTGGGAGCGGGCCTGAGCATAGGG
GCTCAAGAGCCACTTCATGGGTTTCTAATGATAGACTTCACTCTCCTCCCTAAGCTGGGGACCTTGAGTCTTTGCAGAGC
CAACCCTCCACCCCATCCCATCCCACACACATGCACATGAGCACACTCTGCTTTCTGACCTCAACGACTTCATATCCACA
GAGCCTGAGATTCCAGCCCCTATGTCAGAGCTCACAGAGACTGTGGTCTGCGCCCTGGGGTTGTCTGTGGGCCTCGTGGG
CATTGTGGTGGGCACTGTCTTCATCATCCGAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTGTGAATCC
CATCCTGGAATGGAAGGTAAGATTGAGATTTGTTAGAGCTGAATCCGCAGTATGAGAGGAAGGAAAGTGGAGGAGGCTGT
GGACATGAATGGTTGAAAGTTGTAGGGGAATTGGGAAGTGGCATGATGATGACATAGGAGCGGCCTAGGACCCATCCATC
TCATGTCTGTCCTGTTGCAGGTGCATCGCCATCTACAGGAGCAGAAGAGTGGACTTGCTACATGACCTAGCAT

IMGT/HLA

Sponsors

Animated Sponsors Logo