Allele Report for DQA1*05:05:01:02

DQA1*05:05:01:02
Pre-2010 Nomenclature: Local Names: DQA1*05:05
IMGT/HLA Acc No: HLA06614 OMIM Entry: *146880
Assigned: 2011-02-28 Sequence Last Modified: 2011-04-08
Source Entries: AY663394 , HE966411  
Cells Sequence Derived From: 214940 , NA14661  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Raymond CK et al. Genome Res 15:1250-7 2005. (View abstract)
Witter K et al. Tissue Antigens 83:49-51 2014. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (254 aa)
MILNKALMLGTLALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFD
PQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSET
SFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIR
GLRSVGASRHQGPL
Nucleotide Sequence Data (765 bps)
ATGATCCTAAACAAAGCTCTGATGCTGGGGACCCTTGCCCTGACCACCGTGATGAGCCCCTGTGGAGGTGAAGACATTGT
GGCTGACCACGTCGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGATG
GAGATGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGACAATTTAGATTTGAC
CCGCAATTTGCACTGACAAACATCGCTGTCCTAAAACATAACTTGAACAGTCTGATTAAACGCTCCAACTCTACCGCTGC
TACCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACATCCTCATCTGTCTTG
TGGACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACC
AGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCCTCCTCCCTTCTGCTGAGGAGAGTTATGA
CTGCAAGGTGGAGCACTGGGGACTGGACAAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCCCCTATGTCAGAGC
TCACAGAGACTGTGGTCTGCGCCCTGGGGTTGTCTGTGGGCCTCGTGGGCATTGTGGTGGGCACTGTCTTCATCATCCGA
GGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTGTGA
Genomic Sequence Data (6597 bps)
AAAAATTCCTGGAGGTTGTAACTCAGAAAATCCTGAAGGATGCCGTAGAATTGATGACATCATCTATCCACGAGGCTGCT
CAGAAATGCCCACCCCTGGCCAGGGCGGTGGCTCATGCCTGTAATCTGAGCACTTTGGGAGGCTGAGATGGGCAGATCAC
GAATTCAGGAGTTCGAGACCAGCCTGGCCAACATAGTGAAACTCTGTCTCTACTAAAAATACAAAAATTAGCCGGGCGTG
GTGGCAGGCGCCTGTAATCCCAGCTACTTGGGAGGGTGAGACAGGAGAATCACTTGAACCCGGGAGTCAAAGTTTGCAGT
GAGCCGAGACCATGCCATTGCACCTCAGCCTGGGTGACAGAGTGAGACTACATCTCAAAAAAAAAAAAAAAAAAGAAAGA
AAAAAAAGAAAAGAAATGCCCACCCCTCTTGCCACTGGCAGACATGCACACACCAGAGAAGATTCCGATTTCGTGTCCTC
CCTCTATTCACAGAACATTTCCTCAAGTCCACTCTGAGTGGAGGCTGCATCACAACAAGGGGATTGCCCTGTCTCCTTCC
AGGGCTCTTAATACAAACTCTTCAACTAGTAACTGAGGTGTCATCATAGGGGATTTTTCTAATTAGCCAAAACCTGACTT
GGCAGGGTTTGGTTTGGGTGTCTTCAGATTGCCTTGTCTCGAGGTCCTCACAATTGCTCTACAACTCAGAACAGCAACTG
CTAAGGCTGCCTTGGGAAGAGGATGATCCTAAACAAAGCTCTGATGCTGGGGACCCTTGCCCTGACCACCGTGATGAGCC
CCTGTGGAGGTGAAGACATTGTGGGTGAGTGTATGAGTGAGGGATGTTCTCTGGAGCTGGAAGAGAGGAAATTGAAGCAA
AAGAGAGAAAGCGATTTGCAGAGAAATTGTAGAGATTTCCTAAGGGTCCCTTCAGTATTAAGAGATTTAAAAATTATGGC
TGTTCCTCCTTCAGGAAACCAGAGTCCCAACCTACTCTTTTTGTTATCTATGCTGTTGGCGTTCACTAAGGATGCTATTC
TGTTTATATTGTATTCAGTGACTATAGCCTGGAGGTCTCTATGTCATTCCATCATGATTGCCTCAAAAATTAGTGAGGTT
TCCATCAATGGATAATTTTTTATTATTAAAAATTTGTGAAGTATCATTCTCAAATTTCCCTGAACAACTTTTGAAGCTTT
TCGGATGTCTCCTGTAGTAGCGCTTGGGGTAAATGATTCCATCAATTATATACTCTATAGATATTAAGAAAGATGCCCTT
TTCTTTCTCTCAGACTTACTAACATTTCCACGTGGGAACTGGCACAGGTGGGGAGTGGGTAAAGGAGTCCAGCAGGCTGA
ATGCCTTCAACAATCATTTTACCACATGGTCCTCACTTACTCTCAGCTGCCTCATATGTGTCACCTCACAAATAATCAAA
TAAAATGGGCATGTAGCTAAGCTTTGTAAATAGTGAAAACATGAATGTCAATTTTATTTTTACATATTTCTATTATAGGT
ATAGCTTCACATTTCTTTTCTTTTGCAAAATAAGGAATCCTTTTATTTTAAAATTGAGAATTTATAGTAGAAAAACTTGG
TAAATTAAATCATTTTATTCTCAAATTATCAACCCAAATTACCTGTTCTTCAACTCATCTAATGAAGTCCTATAAAAAGA
AAAGTGGGCCAGACATGGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCGAGGCAGGAGGATCCTTTGAGCCCAG
GAGTTGAGACCAGCCTGGGCAACATAGCAAGACCTCATCTCTACAAAAAATAAAAATTAGCCAGGTGTGGTGGTGCATGC
CTGTGGTGCCAGCTACTCAGAAGGCTGCAGTGGGAGGACTGCTTGAGTCCAGGAGGCGGAAGCTGCAGTGAGCCATGATG
GCACCACTACACTCCAGCCAGGGCAACAGAGAGAAACTCTGTCTCAGAAAGAAAAAGGAAAGAAAGAGAGAAAGGAAGGA
AAGAAAGAAAGAAGGAAGGAAGGAAGGAAGAAGGGGAAGGGAAGGGAAGGAAGGGAAGGAAAGGGAAGGGAGGAAAGAAG
GAAGGAAAAAAGAAAAAGAAAGAAAAAAGAAAGAAAAAGAAAGAAAGAAAGAAAAGAGGGAAGGAAAGAAAGAAAAAGGA
AGGAAGGAAGCACAGATTAATTATTAATCATTTGGTCTCTCTTAGTCTTCTCTGTCTTTGTCATCCATCTATTTCCACCT
CTCTTCATGCATTCCTTTCTCCCTCTTCCCTTTCAGGATCCATCTCTGACTCCCTGCTTCTTTATATGGACAGTGGGGTT
TGTAAAACAAAAGTTGAAAAATCAGATAGTTAAAAGGTGAAGTGAACTGGAAGGTCTAAACTTCCACAACCTTATTAACC
ATGGCTGCTCCCATTCTGATTTTGTTCGACGGTGGAAGTTTCACCTCCTTCTCCAGAGCACTTGGCTTCTTTGTTCCAAA
TTTCCTTTCTTCAACCTCACACCAGAGTGCCCTGGTCAGGCTCGGCTCATCCATTAGGCACAACATGGGCAATGCAGAGA
ACCCTCCATACTGTAAAGCCACATGAGAATGTTTTAACTCCTTTTAAGATTAGAAAAAAATGAAATTTCAGAGCCTAAGA
AAATGTTTTAATTCAGCCTAGATTGTATTGTCTTTATACCAATTCAGTCATAAAATACAATTTTCCATATTTTCATGGAG
GAAGGGGCCCACAAAAGCAAGAGTGCTCAGGGCTCACATGTCAGAATGCAGCCCTGGTCATGGCTGATCCTGGCCTTCTT
ATGATTCTGCTAGTGTGCCTGTCCGTCTTCCCCAAAATCTATGTCGTCCTCAAATATAGCAACTGTAATTCAAAACACGT
TTGAGCACACAGTAAGCTAAGTTTTAAGGATTCAAAGATGAAAAGTCATGCTGTCTTCCCTGCAGAGGGTGCTCAGACTA
GTGATGGAAACGGTATGGGATGCAGGAAAGCAGAAGGCCATTGCTGACCAGGGCAGTGGACTCAGCAGAGGCTGAAACTA
TACAAATGACTTGGTTCCAGCTGGGCCAGCAGGGTGACATCCTCCAGCAAAACTCGGCACCCAAGACAAGTCCCAGATGA
AAAGAAGGATTGCTTTGTGTTTGATAAGGAGTCAAGGTTTATTGCAAGGATAAGGCTTTGTTGGTGGCCTGTTAAGACAA
TCCAGGGCAGTCATACTGGATAAGGAAGAAGGTGAGCTGGAAGAGGAACAGACAAACAGCCAGATATTGAGGTGGAGGAG
CTGGAGGTCATAACGTGGTCAAAAACATGTCGATGAGAGGACTTAGCTACAAAGTTGTTAACTTAAGCAGAAACCTCAAG
GATGAATTTTAGGATTTCTCCAGGAAGTCCTAAAAGATAATTTCATTTCAGGGAGAAAAACAACAAACCACTGGAAAGAC
CAGGGAACATGAAAGGATAATGTAGTTTGGTTTGCTTGGCAGATACTTATGAAGGATGTTGGACTGTAAGGCTGTTGATA
GCCTCCTCACAGAACATGCTACAGTACATTGTATCTGCTCCCTTACCTACCTGACTCTTCCACTCTTCAGTTTGTTCCTT
AATGGTAGACCATGCCTGATTGGTGTTTTACACATCCCCTGCTATGTCTGACACTTGTGGATGCTCAGAAAGTGGGGAAG
GAAGGAAAGATACAACGGTAAAAGGCTTACACGTCTTGACAGGAATGTCCAGTTCGGCTCATTTGGCTGGAGCCACATTG
CACGGCTGCCATTCTGCTCTGGCATCCTCAGACAAGCACACTGCCCATTAGAGGAAAAAGGGTTTAATTTACCTGAGTCC
TCAAGTGAATATAAGTGTTAAGTCAGAACACTGTAGACATTTAGTAACCTCCTTCAGAGGAAAAAAAAAGGTGGGGGGAA
ATGACAGAAATCCAAAAACTAGTAGAGCTTCCACTCTTCATTTCAGAAGAAATCAGTTGCTCTCCTCTAAGGACCATTAC
TATTAACAAAACAGAGACCTTGAAGGAGGCATTGTTTATTTATTATATATTTTGTAATGTTATTACCATTCTTGTTATAC
TATTCCTTATACCCTACAATTGTTAGCAGACATTATTTTAAATTAATAAGATCCTGCATGCTTTTCTTTTTTTAAAAAAA
AGAAAGACCTCTGTGTAGAGTGTCCTGTTCTGAGCCAGTCCTGAGAGGAAAGAAAATACAATCAGTTTGTTATTAACTGA
GGAAAGAATTAAGTGAAAGATGAATCTTAGGAAGCAGAAGGAAGTAAACCTAATCTCTGACTAAGAAAGCTAAATACCAT
AATAACTCATTCATTCCTTCTTTTGTTTAATTACATTATTTAATCATAAGTCCGTGATGTGCCAGGCACTCAGGAAATAG
TAAAAACTGGACATGTGATATTCTGCCCTTGTGTAGCGCACATTATAGTGGGAAAGAAAGCGCAATTTTAACCGGACAAC
TACCAACAATAAGAGCGGAGGAAGCAGGGGTTGGAAATGTCCACAGGCTGTGCCAAAGATGAAGCCCGTAATATTTGAAA
GTCAGTTTCTTTCATCATTTTGTGTATTAAGGTTCTTTCTTCCCCTGTTCTCCACCTTCCTGCTTGTCATCTTCACTCAT
CAGCTGACCACGTCGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGAT
GGAGATGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGACAATTTAGATTTGA
CCCGCAATTTGCACTGACAAACATCGCTGTCCTAAAACATAACTTGAACAGTCTGATTAAACGCTCCAACTCTACCGCTG
CTACCAATGGTATGTGTCAACAATTCTGCCCCTCTTTACTGATTTATCCCTTCATACCAAGTTTCATTATTTTATTTCCA
AGAGGTCCCCAGATCTTCTCATGGCAATTGCTGAAATTTTATCATCTCCCATCTCTAAAATCACATATTCCCATGTAATA
CAAGGGTCTTTCCATTATCCATTCATTAAATCCTTCTCGGAGAGGTCTCATCAACCTCCTACTTTATTAAACATGCCCAC
AGAGAGAAGGGCACAGGAATAAAGCGGAGGCAATGTGTCGTTGCTCCCAAGCAGAAGGTAAATAAGACCTCTTTGACTAT
CAGGTGGTGAAATGCTGGTAGGAGGGCTCTTCCAGGATGTAATGCAGAAGCTCATGGCAGAGCTATTCACACTTCACATC
AGTGCTGTTTCCTCACCACAGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACATC
CTCATCTGTCTTGTGGACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCACTCAGTCACAGAAGG
TGTTTCTGAGACCAGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCCTCCTCCCTTCTGCTG
AGGAGAGTTATGACTGCAAGGTGGAGCACTGGGGACTGGACAAGCCTCTTCTGAAACACTGGGGTAAGGATGAGTTCCAC
CACTTTTTGATGCTTTCTTGTCTGTCAAGTTCAGAACTTCCTGCCTTTTACTCCTATATCCCAAAACTTGTTTTCCACAC
TTCATGGGTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTC
TTTCTTTTTTGAAAGAATAAAGCAACAAAAGCAAAGATTTATTGAAAATGAAAGTACACTTCACATGGTGGGAGCGGGCC
TGAGCATAGGGGCTCAAGAGCCACTTCATGGGTTTCTAATGATAGACTTCACTCTCCTCCCTAAGCTGGGGACCTTGAGT
CTTTGCAGAGCCAACCCTCCACCCCATCCCATCCCACACACATGCACATGAGCACACTCTGCTTTCTGACCTCAACGACT
TCATATCCACAGAGCCTGAGATTCCAGCCCCTATGTCAGAGCTCACAGAGACTGTGGTCTGCGCCCTGGGGTTGTCTGTG
GGCCTCGTGGGCATTGTGGTGGGCACTGTCTTCATCATCCGAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCC
CTTGTGAATCCCATCCTGGAATGGAAGGTAAGATTGAGATTTGTTAGAGCTGAATCCGCAGTATGAGAGGAAGGAAAGTG
GAGGAGGCTGTGGACATGAATGGTTGAAAGTTGTAGGGGAATTGGGAAGTGGCATGATGATGACATAGGAGCGGCCTAGG
ACCCATCCATCTCATGTCTGTCCTGTTGCAGGTGCATCGCCATCTACAGGAGCAGAAGAGTGGACTTGCTACATGACCTA
GCATTATTTTCTGGCCCCATTTATCATATCCCTTTTCTCCTCCAAATGTTTCTCCTCTCACCTCTTCTGTGGGACTTAAA
TTGCTATATCTGCTCAGAGCTCACAAATGCCTTTGAATTATTTCCCTGACTTCCTGATTTTTTTCTTTTCTCAAGTGTTA
CCTACTAAGGGATGCCTGGAGTAAGCCACCCAGCTAC

IMGT/HLA

Sponsors

Animated Sponsors Logo