Allele Report for DQA1*05:05:01:01

DQA1*05:05:01:01 View HGVS Report
Pre-2010 Nomenclature: DQA1*0505 Local Names: DQA 4.1
IMGT/HLA Acc No: HLA00619 OMIM Entry: *146880
Assigned: 1998-04-21 Sequence Last Modified: 1999-04-08
Source Entries: AB006908 , AY375947 , AY375948 , AY663412 , L34092 , L46881 , M20506  
Cells Sequence Derived From: BM16 , BM21 , JBUSH , NA00576 , RML , SWEIG007  
Known Ethnic Origin Of Source: American Indian, Caucasoid, Oriental
CWD v2.0 Status: Common
Publications
Horn GT et al. Proc Natl Acad Sci U S A 85:6012-6 1988. (View abstract)
Raymond CK et al. Genome Res 15:1250-7 2005. (View abstract)
Yasunaga S et al. Tissue Antigens 47:37-48 1996. (View abstract)
Liu CP et al. J Immunol 140:3631-9 1988. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 6 Laboratories: 6
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (254 aa)
MILNKALMLGTLALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFD
PQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSET
SFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIR
GLRSVGASRHQGPL
Nucleotide Sequence Data (765 bps)
ATGATCCTAAACAAAGCTCTGATGCTGGGGACCCTTGCCCTGACCACCGTGATGAGCCCCTGTGGAGGTGAAGACATTGT
GGCTGACCACGTCGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGATG
GAGATGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGACAATTTAGATTTGAC
CCGCAATTTGCACTGACAAACATCGCTGTCCTAAAACATAACTTGAACAGTCTGATTAAACGCTCCAACTCTACCGCTGC
TACCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACATCCTCATCTGTCTTG
TGGACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACC
AGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCCTCCTCCCTTCTGCTGAGGAGAGTTATGA
CTGCAAGGTGGAGCACTGGGGACTGGACAAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCCCCTATGTCAGAGC
TCACAGAGACTGTGGTCTGCGCCCTGGGGTTGTCTGTGGGCCTCGTGGGCATTGTGGTGGGCACTGTCTTCATCATCCGA
GGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTGTGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo