Allele Report for DQA1*05:01:01:02

DQA1*05:01:01:02 View HGVS Report
Pre-2010 Nomenclature: Local Names: DQA1*05:01:01:02
IMGT/HLA Acc No: HLA06618 OMIM Entry: *146880
Assigned: 2011-02-28 Sequence Last Modified: 2011-04-08
Source Entries: AL731683 , AL928759 , AY375939 , AY375940 , AY375941 , AY663399 , AY663407  
Cells Sequence Derived From: BRO, LJ , NA01018 , NA10923 , REE, GD , VAVY  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Raymond CK et al. Genome Res 15:1250-7 2005. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 5 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (254 aa)
MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFD
PQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSET
SFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIR
GLRSVGASRHQGPL
Nucleotide Sequence Data (765 bps)
ATGATCCTAAACAAAGCTCTGATGCTGGGGGCCCTTGCCCTGACCACCGTGATGAGCCCCTGTGGAGGTGAAGACATTGT
GGCTGACCACGTCGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGATG
GAGATGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGACAATTTAGATTTGAC
CCGCAATTTGCACTGACAAACATCGCTGTCCTAAAACATAACTTGAACAGTCTGATTAAACGCTCCAACTCTACCGCTGC
TACCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACATCCTCATCTGTCTTG
TGGACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACC
AGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCCTCCTCCCTTCTGCTGAGGAGAGTTATGA
CTGCAAGGTGGAGCACTGGGGCCTGGACAAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCCCCTATGTCAGAGC
TCACAGAGACTGTGGTCTGCGCCCTGGGATTGTCTGTGGGCCTCGTGGGCATTGTGGTGGGCACTGTCTTCATCATCCGA
GGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTGTGA
Genomic Sequence Data (6529 bps)
AAAAATTCCTGGAGGTTGTAACTCAGAAAATCCTGAAGGATGCCGTATAATTGATGATGTCATCTATCCACGAGGCTGCT
CAGAAATGCCCACCCCTGGCCAGGGCGGTGGCTCATGCCTGTAATCTGAGCACTTTGGGAGGCTGAGATGGGCAGATCAC
GAATTCAGGAGTTCGAGACCAGCCTGGCCAACATAGTGAAACTCTGTCTCTACTAAAAATACAAAAATTAGCCGGGCGTG
GTGGCAGGTGCCTGTAATCCCAGCTACTTGGGAGGGTGAGACAGGAGAATCACTTGAACCCGGGAGTCAAAGTTTGCAGT
GAGCCGAGACCATGCCATTGCACCTCAGCCTGGGTGACAGAGTGAGACTACATCTCAAAAAAAAAAAAAAAGAAAGAAAG
AAAAAAAGAAAAGAAATGCCCACCCCTCTTGCCACTGGCAGACATGCACACACCAGAGAAGATTCCGATTTCGTGTCCTC
CCTCTATTCACAGAACATTTCCTCAAGTCCACTCTGAGTGGAGGCTGCATCACAACAAGGGGATTGCCCTGTCTCCTTCC
AGGGCTCTTAATACAAACTCTTCAACTAGTAACTGAGGTGTCATCATAGGGGATTTTTCTAATTAGCCAAAACCTGACTT
GGCAGGGTTTGGTTTGGGTGTCTTCAGATTGCCTTGTCTCGAGGTCCTCACAATTGCTCTACAACTCAGAACAGCAACTG
CTAAGGCTGCCTTGGGAAGAGGATGATCCTAAACAAAGCTCTGATGCTGGGGGCCCTTGCCCTGACCACCGTGATGAGCC
CCTGTGGAGGTGAAGACATTGTGGGTGAGTGTATGAGTGAGGGATGTTCTCTGGAGCTGGAAGAGAGGAAATTGAAGCAA
AAGAGAGAAAGCGATTTGCAGAGAAATTGTAGAGATTTCCTAAGGGTCCCTTCAGTATTAAGAGATTTAAAAATTATGGC
TGTTCCTCCTTCAGGAAACCAGAGTCCCAACCTACTCTTTTTGTTATCTATGCTGTTGGCGTTCACTAAGGATGCTATTC
TGTTTATATTGTATTCAGTGACTATAGCCTGGAGGTCTCTATGTCATTCCATCATGATTGCCTCAAAAATTAGTGAGGTT
TCCATCAATGGATAATTTTTTATTATTAAAAATTTGTGAAGTATCATTCTCAAATTTCCCTGAACAACTTTTGAAGCTTT
TCGGATGTCTCCTGTAGTAGCGCTTGGGGTAAATGATTCCATCAATTATATACTCTATAGATATTAAGAAAGATGCCCTT
TTCTTTCTCTCAGACTTACTAACATTTCCACGTGGGAACTGGCACAGGTGGGGAGTGGGTAAAGGAGTCCAGCAGGCTGA
ATGCCTTCAACAATCATTTTACCACATGGTCCTCATTTACTCTCAGCTGCCTCATATGTGTCACCTCACAAATAATCAAA
TAAAATTGGCATGTAGCTAAGCTTTGTAAATAGTGAAAACATGAATGTCAATTTTATTTTTACATATTTCTATTATAGGT
ATAGCTTCACATTTCTTTTCTTTTGCAAAATAAGGTATCCTTTTATTTTAAAATTGAGAATTTATAGTAGAAAAACTTGG
TAAATTAAATCATTTTATTCTCAAATTATCAACCCAAATTACCTGTTCTTCAACTCATCTAATGAAGTCCTATAAAAAGA
AAAGTGGGCCAGACATGGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCGAGGCAGGAGGATCCTTTGAGCCCAG
GAGTTGAGACCAGCCTGGGCAACATAGCAAGACCTCATCTCTACAAAAAATAAAAATTAGCCAGGTGTGGTGGTGCATGC
CTGTGGTGCCAGCTACTCAGAAGGCTGCAGTGGGAGGACTGCTTGAGTCCAGGAGGCGGAAGCTGCAGTGAGCCATGATG
GCACCACTACACTCCAGCCAGGGCAACAGAGAGAAACTCTGTCTCAAAAAGAAAAAGGAAAGAAAGAGAGAAAGGAAGGA
AAGAAAGAAAGAAGGAAGGAAGGAAGGAAGGAAGAAGGGGAAGGGAAGGGAAGGAAGGGAAGGAAAGGGGAGGAAAGAAG
GAAGGAAAAAAGAAAAAGAAAGAAAAAAGAAAGAAAAAGAAAGAAAGAAAGAAAAGAGGGAAGGAAAGAAAGAAAAAGGA
AGGAAGGAAGCACAGATTAATTATTAATCATTTGGTCTCTCTTAGTCTTCTCTGTCTTTGTCATCCATCTATTTCCACCT
CTCTTCATGCATTCCTTTCTCCCTCTTCCCTTTCAGGATCCATCTCTGACTCCCTGCTTCTTTATATGGACAGTGGGGTT
TGTAAAACAAAAGTTGAAAAATCAGATAGTTAAAAGGTGAAGTGAACTGGAAGGTCTAAACTTCCACAACCTTATTAACC
ATGGCTGCTCCCATTCTGATTTTGTTCGACGGTGGAAGTTTCACCTCCTTCTCCAGAGCACTTGGCTTCTTTGTTCCAAA
TTTCCTTTCTTCAACCTCACACCAGAGTGCCCTGGTCAGGCTCGGCTCATCCATTAGGCACAACATGGGCAATGCAGAGA
ACCCTCCATACTGTAAAGCCACATGAGAATGTTTTAACTCCTTTTAAGATTAGAAAAAAATGAAATTTCAGAGCCTAAGA
AAATGTTTTAATTCAGCCTAGATTGTATTGTCTTTATACCAATTCAGTCATAAAATACAATTTTCCATATTTTCATGGAG
GAAGGGGCCCACAAAAGCAAGAGTGCTCAGGGCTCACATGTCAGAATGCAGCCCTGGTCATGGCTGATCCTGGCCTTCTT
ATGATTCTGCTAGTGTGCCTGTCCATCTTCCCCAAAATCTATGTCGTCCTCAAATATAGCAACTGTAATTCAAAACACGT
TTGAGCACACAGTAAGCTAAGTTTTAAGGATTCAAAGATGAAAAGTCATGCTGTCTTCCCTGCAGAGGGTGCTCAGACTA
GTGACGGAAACGGTATGGGATGCAGGAAAGCAGAAGGCCATTGCTGACCAGGGCAGTGGACTCAGCAGAGGCTGAAACTA
TACAAATGACTTGGTTCCAGCTGGGCCAGCAGGGTGACATCCTCCAGCAAAACTCGGCACCCAAGACAAGTCCCAGATGA
AAAGAAGGATTGCTTTGTGTTTGATAAGGAGTCAAGGTTTATTGCAAGGATAAGGCTTTGTTGGTGGCCTGTTAAGACAA
TCCAGGGCAGTCATACTGGATAAGGAAGAAGGTGAGCTGGAAGAGGAACAGACAAACAGCCAGATATTGAGGTGGAGGAG
CTGGAGGTCATAACGTGGTCAAAAACATGTCGATGAGAGGACTTAGCTACAAAGTTGTTAACTTAAGCAGAAACCTCAAG
GATGAATTTTAGGATTTCTCCAGGAAGTCCTAAAAGATAATTTCATTTCAGGGAGAAAAACAACAAACCACTGGAAAGAC
CAGGGAACATGAAAGGATAATGTAGTTTGGTTTGCTTGGCAGATACTTATGAAGGATGTTGGACTGTAAGGCTGTTGATA
GCCTCCTCACAGAACATGCTACAGTACATTGTATCTGCTCCCTTACCTACCTGACTCTTCCACTCTTCAGTTTGTTCCTT
AATGGTAGACCATGCCTGATTGGTGTTTTACACATCCCCTGCTATGTCTGACACTTGTGGATGCTCAGAAAGTGGGGAAG
GAAGGAAAGATACAACGGTAAAAGGCTTACACGTCTTGACAGGAATGTCCAGTTCGGCTCATTTGGCTGGAGCCACATTG
CACGGCTGCCATTCTGCTCTGGCATCCTCAGACAAGCACACTGCCCATTAGAGGAAAAAGGGTTTAATTTACCTGAGTCC
TCAAGTGAATATAAGTGTTAAGTCAGAACACTGTAGACATTTAGTAACCTCCTTCAGAGGAAAAAAAAAGGTGGGGGGAA
ATGACAGAAATCCAAAAACTAGTAGAGCTTCCACTCTTCATTTCAGAAGAAATCAGTTGCTCTCCTCTAAGGACCATTAC
TATTAACAAAACAGAGACCTTGAAGGAGGCATTGTTTATTTATTATATATTTTGTAATGTTATTACCATTCTTGTTATAC
TCTTCCTTATACCCTACAATTGTTAGCAGACATTATTTTAAATTAATAAGATCCTGCATGCTTTTCTTTTTTTTAAAAAA
AGAAAGACCTCTGTGTAGAGTGTCCTGTTCTGAGCCAGTCCTGAGAGGAAAGAAAATACAATCAGTTTGTTATTAACTGA
TGAAAGAATTAAGTGAAAGATGAATCTTAGGAAGCAGAAGGAAGTAAACCTAATCTCTGACTAAGAAAGCTAAATACCAT
AATAACTCATTCATTCCTTCTTTTGTTCAATTACATTATTTAATCATAAGTCCGTGATGTGCCAGGCACTCAGGAAATAG
TAAAAACTGGACATGTGATATTCTGCCCTTGTGTAGCGCACATTATAGTGGGAAAGAAAGCGCAATTTTAACCGGACAAC
TACCAACAATAAGAGTGGAGGAAGCAGGGGTTGGAAATGTCCACAGGCTGTGCCAAAGATGAAGCCCGTAATATTTGAAA
GTCAGTTTCTTTCATCATTTTGTGTATTAAGGTTCTTTCTTCCCCTGTTCTCCACCTTCCTGCTTGTCATCTTCACTCAT
CAGCTGACCACGTCGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGAT
GGAGATGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGACAATTTAGATTTGA
CCCGCAATTTGCACTGACAAACATCGCTGTCCTAAAACATAACTTGAACAGTCTGATTAAACGCTCCAACTCTACCGCTG
CTACCAATGGTATGTGTCAACAATTCTGCCCCTCTTTACTGATTTATCCCTTCATACCAAGTTTCATTATTTTATTTCCA
AGAGGTCCCCAGATCTTCTCATGGCAATTGCTGAAATTTTATCATCTCCCATCTCTAAAATCACATATTCCCATGTAATA
CAAGGGTCTTTCCATTATCCATTCATTAAATCCTTCTCGGAGAGGTCTCATCAACCTCCTACTTTATTAAACATGCCCAC
AGAGAGAAGGGCACAGGAATAAAGCGAAGGCAATGTGTCGTTGCTCCCAAGCAGAAGGTAAATAAGACCTCTTTGACTAT
CAGGTGGTGAAATGCTGGTAGGAGGGCTCTTCCAGGATGTAATGCAGAAGCTCATGGCAGAGCTATTCACACTTCACATC
AGTGCTGTTTCCTCACCACAGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACATC
CTCATCTGTCTTGTGGACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCACTCAGTCACAGAAGG
TGTTTCTGAGACCAGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCCTCCTCCCTTCTGCTG
AGGAGAGTTATGACTGCAAGGTGGAGCACTGGGGCCTGGACAAGCCTCTTCTGAAACACTGGGGTAAGGATGAGTTCCAC
CACTTTTTGATGCTTTCTTGTCTGTCAAGTTCAGAACTTCCTGCCTTTTACTCCTATATCCCAAAACTTGTTTTCCACAC
TTCATGGGTTTCTTTCTTTCTTTTGAAAGAATAAAGCAACAAAAGCAAAGATTTATTGAAAATGAAAGTACACTTCACAG
GGTGGGAACGGGCCTGAGCATAGGGGCTCAAGAGCCACTTCATGGTTTTCTAATGATAGACTTCACTCTCCTCCCTAAGC
TGGGGACCTTGAGTCTTTGCAGAGCCAACCCTCCACCCCATCCCATCCCACACACATGCACATGAGCACACTCTGCTTTC
TGACCTCAACGACTTCATATCCACAGAGCCTGAGATTCCAGCCCCTATGTCAGAGCTCACAGAGACTGTGGTCTGCGCCC
TGGGATTGTCTGTGGGCCTCGTGGGCATTGTGGTGGGCACTGTCTTCATCATCCGAGGCCTGCGTTCAGTTGGTGCTTCC
AGACACCAAGGGCCCTTGTGAATCCCATCCTGGAATGGAAGGTAAGATTGAGATTTGTTAGAGCTGAATCCGCAGTATGA
GAGGAAGGAAAGTGGAGGAGGCTGTGGACATGAATGGTTGAAAGTTGTAGGGGAATTGGGAAGTGGCATGATGATGACAT
AGGAGCGGCCTAGGACCCATCCATCTCATGTCTGTCCTGTTGCAGGTGCATCGCCATCTACAGGAGCAGAAGAGTGGACT
TGCTACATGACCTAGCATTATTTTCTGGCCCCATTTATCATATCCCTTTTCTCCTCCAAATGTTTCTCCTCTCACCTCTT
CTGTGGGACTTAAATTGCTATATCTGCTCAGAGCTCACAAATGCCTTTGAATTATTTCCCTGACTTCCTGATTTTTTTCT
TCTTAAGTGTTACCTACTAAGAGTTGCCTGGAGTAAGCCACCCAGCTAC

IMGT/HLA

Sponsors

Animated Sponsors Logo