Allele Report for DQA1*05:10

DQA1*05:10 View HGVS Report
Pre-2010 Nomenclature: DQA1*0510 Local Names: DQA1*05new
IMGT/HLA Acc No: HLA04360 OMIM Entry: *146880
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: GU014287  
Cells Sequence Derived From: CTM-8005076  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Balas A et al. Tissue Antigens 75:287-288 2010. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (175 aa)
DHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLVKRSNSTAAT
NEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDC
KVEHWGLDKPLLKHW
Nucleotide Sequence Data (528 bps)
CTGACCACGTCGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGATGGA
GATGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGACAATTTAGATTTGACCC
GCAATTTGCACTGACAAACATCGCTGTCCTAAAACATAACTTGAACAGTCTGGTTAAACGCTCCAACTCTACCGCTGCTA
CCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACATCCTCATCTGTCTTGTG
GACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACCAG
CTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCCTCCTCCCTTCTGCTGAGGAGAGTTATGACT
GCAAGGTGGAGCACTGGGGACTGGACAAGCCTCTTCTGAAACACTGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo