Allele Report for DQA1*04:03N

DQA1*04:03N View HGVS Report
Pre-2010 Nomenclature: DQA1*0403N Local Names: 1242
IMGT/HLA Acc No: HLA01774 OMIM Entry: *146880
Assigned: 2003-07-31 Sequence Last Modified: 2003-10-15
Source Entries: AF448425  
Cells Sequence Derived From: 1242  
Known Ethnic Origin Of Source: Black
Publications
Luo M et al. Tissue Antigens 63:609-11 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (48 aa)
DHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRX
Nucleotide Sequence Data (246 bps)
CTGACCATGTTGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGATGGA
GACGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGATAATTTAGATTTGACCC
GCAATTTGCACTGACAAACATCGCTGTGACAAAACACAACTTGAACATCCTGATTAAACGCTCCAACTCTACTGCTGCTA
CCAATG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo