Allele Report for DQA1*04:01:01

DQA1*04:01:01 View HGVS Report
Pre-2010 Nomenclature: DQA1*040101 Local Names: DQA 4.2, 2041C17
IMGT/HLA Acc No: HLA00612 OMIM Entry: *146880
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: L34090 , L46880 , M33906  
Cells Sequence Derived From: 2041 , ARC , MADURA , SPACH , SPL  
Known Ethnic Origin Of Source: American Indian, Black, Caucasoid
Publications
Horn GT et al. Proc Natl Acad Sci U S A 85:6012-6 1988. (View abstract)
Hurley CK et al. J Immunol 140:885-92 1988. (View abstract)
Todd JA et al. Nature 329:599-604 1987. (View abstract)
Jonsson AK et al. Immunogenetics 30:232-4 1989. (View abstract)
Yasunaga S et al. Tissue Antigens 47:37-48 1996. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 5 Laboratories: 5
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (254 aa)
MILNKALLLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFD
PQFALTNIAVTKHNLNILIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSET
SFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIR
GLRSVGASRHQGPL
Nucleotide Sequence Data (765 bps)
ATGATCCTAAACAAAGCTCTGCTGCTGGGGGCCCTTGCCCTGACCACCGTGATGAGCCCCTGTGGAGGTGAAGACATTGT
GGCTGACCATGTTGCCTCTTATGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGATG
GAGACGAGCAGTTCTACGTGGACCTGGGGAGGAAGGAGACTGTCTGGTGTTTGCCTGTTCTCAGACAATTTAGATTTGAC
CCGCAATTTGCACTGACAAACATCGCTGTGACAAAACACAACTTGAACATCCTGATTAAACGCTCCAACTCTACTGCTGC
TACCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACGCTGGGTCAGCCCAACACCCTCATCTGTCTTG
TGGACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACC
AGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCTTCCTCCCTTCTGCTGATGAGATTTATGA
CTGCAAGGTGGAGCACTGGGGCCTGGACGAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCCCCTATGTCAGAGC
TCACAGAGACTGTGGTCTGCGCCCTGGGATTGTCTGTGGGCCTCGTGGGCATTGTGGTGGGCACTGTCTTCATCATCCGA
GGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTGTGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo