Allele Report for DQA1*03:03:01

DQA1*03:03:01 View HGVS Report
Pre-2010 Nomenclature: DQA1*0303 Local Names: DQA1*0302YT
IMGT/HLA Acc No: HLA00611 OMIM Entry: *146880
Assigned: 1995-09-18 Sequence Last Modified: 1998-12-16
Source Entries: AY663393 , CR933859 , L34089 , L46878  
Cells Sequence Derived From: NA14661 , YT  
Known Ethnic Origin Of Source: Black, Oriental
Publications
Raymond CK et al. Genome Res 15:1250-7 2005. (View abstract)
Yasunaga S et al. Tissue Antigens 47:37-48 1996. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (255 aa)
MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFRRFRRF
DPQFALTNIAVLKHNLNIVIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSE
TSFLSKSDHSFFKISYLTFLPSDDEIYDCKVEHWGLDEPLLKHWEPEIPTPMSELTETVVCALGLSVGLVGIVVGTVLII
RGLRSVGASRHQGPL
Nucleotide Sequence Data (768 bps)
ATGATCCTAAACAAAGCTCTGATGCTGGGGGCCCTCGCCCTGACCACCGTGATGAGCCCTTGTGGAGGTGAAGACATTGT
GGCTGACCATGTTGCCTCTTACGGTGTAAACTTGTACCAGTCTTATGGTCCCTCTGGGCAGTACAGCCATGAATTTGATG
GAGACGAGGAGTTCTATGTGGACCTGGAGAGGAAGGAGACTGTCTGGCAGTTGCCTCTGTTCCGCAGATTTAGAAGATTT
GACCCGCAATTTGCACTGACAAACATCGCTGTGCTAAAACATAACTTGAACATCGTGATTAAACGCTCCAACTCTACCGC
TGCTACCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACACCCTCATCTGTC
TTGTGGACAACATCTTTCCTCCTGTGGTCAACATCACCTGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAG
ACCAGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCTTCCTCCCTTCTGATGATGAGATTTA
TGACTGCAAGGTGGAGCACTGGGGCCTGGATGAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAACACCTATGTCAG
AGCTCACAGAGACTGTGGTCTGCGCCCTGGGGTTGTCTGTGGGCCTCGTGGGCATTGTGGTGGGGACCGTCTTGATCATC
CGAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTGTGA
Genomic Sequence Data (6437 bps)
AAAAATTCCTGGAGGTTGTAACCCAGAAAATCCTGAAGGATGCCATATAACTGATGACCTCATCTATCCATGAGGCTGCT
CAGAAATGCCCTCCCCTGGCCAGGCACGGTGGCTCATGCCTGTAATCCAAGCACTTTGGGAGGCTGAGGCAGGCAGATCA
TGAGGTCAGGAGTTCAAGACCAGCGTGGCCAACATAGTGAAACTCTGTCTCTACTAAAAATACAGAAATTAGCCGGGCAT
GGTGGCAGCCGCCTGCAGTCCCAGCTACTCGGGAGGGTGAGGCAGGAGAATCGCTTGAACCTGGGAGGCAAAGGTTGCAG
TGAGCCGAGACCATGCCATTGTACCTCAGCCTGGGTGACAGAGTGAGACTACGTCTCGAAAAGAAAAGAAAAAGAAAAGA
AAAAGAAAAAAAAAGAAAAATGCCCATCCCTCTTGCGAATGGCAGACATGCACACACCAGAGAAGATTCCAATTTAGTGT
CCTCCCTCTGTTCATAGAACAATTCCTCAAGTCCACTCTGAGTAGAGGCTGCATCACAACAAGGGGATTGCCCTGTCTCC
TTCCAGGGCTCTTAATACAAACTCTTCAGCTAGTAACTGAGATGTCACCATGGGGGATTTTTCTAATTGGCCAAAACCTG
ACCTGGCAGGGTTTGGTTTGGGTGTCTTCAGATTTCCTTGTCTTGAGGCCCTCACAATTGCTCTACAGCTCAGAACAGCA
ACTGCTGAGGCTGCCTTGGGAAGAGGATGATCCTAAACAAAGCTCTGATGCTGGGGGCCCTCGCCCTGACCACCGTGATG
AGCCCTTGTGGAGGTGAAGACATTGTGGGTGAGTGCATGAGTGAGGAATGTTCTCTGGAGCTGAAAAACAGTAAATTGAA
GGAAAAGAGAGAAAGCGATTTGCAGAGAAATTGTAGAGATTTCCTAAGACCCCTTTCAGTATTAAGAGAATTAAAAATTA
TAGCTGTTCCTCCTTCAGGAAACCAGAGCCCCAACCTACTCTTTTTGTTATGTATGCTTTTGTGTTCACTAAGGATGCTA
TTCTGTTTATATTATATTCAGTGACAACAGCCTGGAGGTCTCTATGTCGTTCCGTCATGATTGCCTCAAAAATTAGTGAA
GTTTCCATCAGTGGATAATTTTTTATTATTAAAAATGTATGAAGTGTCATTCTCAAATTTCCCTGAACAACTTTTGAAGC
TTTTCGTATGTCTCCTGTAGTAGATCTTGGGGTCGTTCCATCAATTATATACTCTATAGATATTAAAAAAGTTGCCCGTT
TCTTTCTCTCAGACTTACTCACATTTCCACATGGGAACTGGCACAGGTGGGGAGTGGGTAAAGGAGTCCAGCAGGCTGAA
TGCCTTCAACAATCATTTTACCACATGGTCCTCACTTACTCTCAGCTGCCTCATATGTGTCACCTCACAAATAATCAAAT
AAAATGGGCATGTAGCTAAGCTTTGTAAATAGTGAAAACATGGATGTCAATTGTTTTTACATATTTCTATTACAGGTATA
GCTTCACATTTTTCTTTAGCAAAATAAGGGATCCTTTTAGTTTAAAATTGAGAAGTAGAAAAAATTGGTAAATTAAATCA
TTTTATTCTCAAATTATCAACCCAAATTACCTGTTCTTCACCTCATCTAATAAAGTCCTATAAAAAGAAAAGTGGGCCAG
ACATGGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCGAAGCAGGAGGATCATTTGAGCCTGGGAGTTTGAGACC
AGCCTGGGCAACATAGCAAGACCTCATCTCTACCAAAAAATAAAATAAAAATTAGCCAGGTGTGGTGGTGCATGCCTGTG
GTGCCAGCTACTCAGAAGGCTGCAGTGGGAGGAGCACTTGAGTCCAGGAGGTGGAAGCTGCAGTGAGCCATGATGGCACC
ACTACACTCCAGCCAGGGCAACAGAGAGAGACTCTGTCTCAAAAAGAAAGAGGAAAGAAAGAGAGAAAGGAAGGAAAGAA
GGAAAGAAGGAAGGAAGGAAGGAGAAAGGGAAGGGAGGAAGGAAAAAAGAAAGAAAGAAAGAAAACGGAAGGAAGGAAGC
ACAGATTAATTATTTGGTCTCTTTGTCTCCTCTGCCTTTGTCGTCCATCTCTTCCCACCTCTCTTCATGCATTCCTTTCT
CCCTCTTCCCTTTCAGGATCCATCTCTGACTCCCTGCTCCTTTATAGAGATGGACAGTGAGTTTGTAAAACAAAAGTTGA
AAAGTCAGATAGTTAAAAGGGGAAGTGAACTGGAAGGTACTCTAAACTTTCACAACCTTATTAACCATGGCTGCTCCCAT
TCTGATTTTGTTCAGCAGTGGAAGTTTCACCCGCTCCTCCAGAGCGCTTGGCTTCTTTGTTCCAAATTTCCTTTCTTCAA
CCTCACACCAGAGTGCCCTGGTCAGGCTCAGCTCATCCATTAGGCACAATGTGGGCAGTGCAGGGGACCCTCCAGACTGT
AAAGCCACATGAGAATGTTTTAACTCCTTTTAAAATTATAAAAAAATGAAATTGTAGAGCCTAAGAAAATGTTTTAACTT
TTAATTCAGCCTAGATTATATTGTCTTTATACCAATTCAGTCATAAAATATAGTTTTCCATATTTTTATGGAGGAAGGCG
TCCACACAAGCAAGAGTGCTTGGGGCTCACATGTCAGAACGCAACCCTGATCATGGCTGATCCTGGCCTTCGTGTGGTTC
TGCTAACTATGTGCCTGTCAGTCTTCCCCAAAATCTATGTGGTCCTCAAATATAACAACTGTCATTCAATACACATGTTT
GAGCACCCAGTGAGCTAAGTTTTAAGGATTCAAAGATGAAAAGTCATGCTGTCTCCTCTGCAAAGGGTGCTCAGACTAGT
GATGGAAACAGTATGGGATGAAAGAAAGCAGAAGGCCATTGCTGAGCAGGCAGTGGACTCAGCAGAGGCTGAAACTATAC
AAGTGACTTGGTTCCAGCTGGGCCAGCAGGATAACCAGATGAAAAGAAGGATTGCATATATTCCATATATATTTATGTTT
GAACAAAGAGTCAAGGTTTATTGCAAGGATAAGGAGGTTTTGTTGGTGGCCTGTTAAGACCATCCAGGGTGGTCATACTG
GATAGGGAAGAAGGTGAGCTGGAAGAGGAACAGACAAACTTGGATGGCCAGATGTTGAGATGGAGGAGATGGAGGTCATA
ACGTGGTCAAAAACATGTTGATGAGAGGACTTAGCTACAAAGTTGTTAACTTAAGCAGAAACCTCAAGGATTGATTTTAT
GATTTCTCCAGGAAGTCCTAAAAGTTAATTTCATTTCAGGGAGAAAAACAACAGACCACTGCAAAGACCAGGAACATGAA
AGGATAATGTAGTTTGGTTTGCTTGGCAGATACTTGTGAAAGATGTTGGACTGTAAGGCTGTCAATATCCTCCTCGCAGA
ACTTACTACAGTACATTGTATCTGCTCCCTTACCTACCTGACTCTCCCACTATTCAGTTTGTTCCTTAATGGTAGACCAT
GCCTGATCGGTGTTTTACACATCCCCTGCTATGTCTGATACTTGTGGATGCTCAGAAAGTGGGGAAGGAAGGAAAGATAC
GATGGTAAAAGGCTTACACATGTCTTGAGCAGAATGTTCAGTTTGGCTCATTTGGCTGGAGTCATACTGCATGGCTGCCA
TTCTGCTCTGGCATCCTCAGAGAAGCACACTGCCCATTAAAGGAAAAAGGGTGAATACAAATGTTGAGTCAGAACACTGC
AGACATTTAGTAACCTCCTTCAGAGGAAAAAAAAAGGTGGGGGGAATGACAGAAATCCAAAAACTAGTAGAGCTTCCACT
TTTTCATTTCAGAAGAAATCAGTTACTCTCCTCTAAGGACCATTACTATTAACAAAACAGAGACCTTAGAAGGAAGCATT
ATTTACTTATCATATATTTTGTAATGTTATTACCCTTCTTGTTATACTCTTTCTTATACCCTACCATTGTTAGCAGAAAT
TATTTTAAATTAATAAGATCCTGCATGCTTTTCCTTTTTCTAAAAAAAGAAAGATCTCTGTGTAGAATGTCCTGTTCTGA
GCCAGTCCTGAGAGGAAAGGAAGTATAATCAATTTGTTATTAACTGATGAAAGAATTAAGTGAAAGATAAACCTTAGGAA
GCAGAGGGAAGTTAATCTATGACTAAGAAAGTTAAGTACTCTGATAACTCATTCATTCCTTCTTTTGTTCATTTACATTA
TTTAATCACAAGTCTATGATGTGCCAGGCACTCAGGAAATAGTGAAAATTGGACACGCGATATTCTGCCCTTGTGTAGCA
CACACCGTAGTGGGAAAGAAAGTGCACTTTTAACCGGACAACTATCAACACGAAGAGGGGAGGAAGCAGGGGCTGGAAAT
GTCCACAGACTTTGCCAAAGACAAAGCCCATAATATCTGAAAGTCAGTTTCTTCCATCATTTTGTGTATTAAGGTTCTTT
ATTCCCCTGTTCTCTGCCTTCCTGCTTGTCATCTTCACTCATCAGCTGACCATGTTGCCTCTTACGGTGTAAACTTGTAC
CAGTCTTATGGTCCCTCTGGGCAGTACAGCCATGAATTTGATGGAGACGAGGAGTTCTATGTGGACCTGGAGAGGAAGGA
GACTGTCTGGCAGTTGCCTCTGTTCCGCAGATTTAGAAGATTTGACCCGCAATTTGCACTGACAAACATCGCTGTGCTAA
AACATAACTTGAACATCGTGATTAAACGCTCCAACTCTACCGCTGCTACCAATGGTATGTGTCCACCATTCTGCCTTTCT
TTACTGATTTATCCCTTTATACCAAGTTTCATTATTTTCTTTCCAAGAGGTCCCCAGATCTTCTCATGGCAATTGCTGAA
ATTTTATCATTTCTCATCTCTAAAATCACATATTCCAATGTAATACAAGGGTCTTTCCATTATGCATTCATTAAATCCTT
CTAGGAGAGGTCTCATCAACCTTCTACTTTATTAAACATGCCCACAGAGAGAAGGGCACAGGAGTAAAGCAGAGGCAATG
TGTCGTTGCTCCCAAATGTGTCGTTACAATGTGTCGTTGCTTACCCAAAGAGGTAAATAAGGCCTCTTTGACCAGCAGGA
GAGGAAATGCTGGTAGGAAGACTCTTCCAGGATGTAATGCAGAAGAAGCTCAGGGCAGAGCTATTCACACTTTACACCAG
TGCTGTTTCCTCACCATAGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACACCCT
CATCTGTCTTGTGGACAACATCTTTCCTCCTGTGGTCAACATCACCTGGCTGAGCAATGGGCACTCAGTCACAGAAGGTG
TTTCTGAGACCAGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCTTCCTCCCTTCTGATGAT
GAGATTTATGACTGCAAGGTGGAGCACTGGGGCCTGGATGAGCCTCTTCTGAAACACTGGGGTAAGGATGAGTTTCACCA
TTTTTTGATGCTTTCTTGTCTGTCAAGTTCAGAACTTCCTGCCTTTTACTCTATATCCCAAAACTTGTTTTCCACACTTC
ATGAGTTTCTTTTGTCTTTTTTTTGAAAGAATTAAGCAACAAAAGCACAGATTTATTAAAAAAGAAAGTACACTCCACAG
GGTGGGAGCAGGCCTGCCACTTCATGGGTTTCTAATAACAGACTTCACTCTCCTCCCTAAGCTGGGGGCCTTGAGTCTTT
GCAGAGCCAACCCTCTACCCCATCCCATCCCACACACATGCACATGAGCAAACTCTGCATTCTGACCTCAACAACTTCAC
TTCCACAGAGCCTGAGATTCCAACACCTATGTCAGAGCTCACAGAGACTGTGGTCTGCGCCCTGGGGTTGTCTGTGGGCC
TCGTGGGCATTGTGGTGGGGACCGTCTTGATCATCCGAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTG
TGAATCCCATCCTGAAAAGGAAGGTAAGATTGAGATTTGTTAGAGCTGAAGCTGCAGGAAGGAAAGTGGGAGGAGGCTGT
GGACATGAATGTGGTTGAAAGTTGTAGGGGAATTGGGAAGTGGCATGATGATGACACAGGAGCCCCCTTGGACCCATCGA
TCTCATGTCTGTCCTGTTGCAGGTGCATCACCATCTACAGCAGCGGAAGAGTGGACTTGCTACATGACCTAGCACTATTC
TCTGGCCCGATTTATCATACCCTTTTTCTCCTGCAAATGTTTCTCCTCTTACCTTTTCTCTGCTTTTTTTTTCTTAAGCT
TCTGTATCCCCTCAGAGCTCACAAATGCCTTTGAATTCTTTCCCTGACCTCCTGATTTTTTTTTCTTTTCTCAGGTGTTA
CCTACTAAGAGATGCCTGGGGTAAGCCGCCCAGCTAC

IMGT/HLA

Sponsors

Animated Sponsors Logo