Allele Report for DQA1*02:01

DQA1*02:01 View HGVS Report
Pre-2010 Nomenclature: DQA1*0201 Local Names: DS7
IMGT/HLA Acc No: HLA00607 OMIM Entry: *146880
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: CR753309 , CR753835 , K01172 , L34087 , L46878 , X00033  
Cells Sequence Derived From: BEI , DBB , DM24 , DM28 , DM29 , LG-10 , MOU  
Known Ethnic Origin Of Source: Caucasoid
Publications
Todd JA et al. Nature 329:599-604 1987. (View abstract)
Chang HC et al. Nature 305:813-5 1983. (View abstract)
Yasunaga S et al. Tissue Antigens 47:37-48 1996. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 7 Laboratories: 4
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (254 aa)
MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQFTHEFDGDEEFYVDLERKETVWKLPLFHRLRFD
PQFALTNIAVLKHNLNILIKRSNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSET
SFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVLIIR
GLRSVGASRHQGPL
Nucleotide Sequence Data (765 bps)
ATGATCCTAAACAAAGCTCTGATGCTGGGGGCCCTCGCCCTGACCACCGTGATGAGCCCTTGTGGAGGTGAAGACATTGT
GGCTGACCACGTTGCCTCTTACGGTGTAAACTTGTACCAGTCTTACGGTCCCTCTGGCCAGTTCACCCATGAATTTGATG
GAGACGAGGAGTTCTATGTGGACCTGGAGAGGAAGGAGACTGTCTGGAAGTTGCCTCTGTTCCACAGACTTAGATTTGAC
CCGCAATTTGCACTGACAAACATCGCTGTGCTAAAACATAACTTGAACATCCTGATTAAACGCTCCAACTCTACCGCTGC
TACCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACACCCTCATCTGTCTTG
TGGACAACATCTTTCCTCCTGTGGTCAACATCACCTGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACC
AGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCTTCCTCCCTTCTGCTGATGAGATTTATGA
CTGCAAGGTGGAGCACTGGGGCCTGGATGAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCACCTATGTCAGAGC
TCACAGAGACTGTGGTCTGTGCCCTGGGGTTGTCTGTGGGCCTCGTGGGCATTGTGGTGGGGACCGTCTTGATCATCCGA
GGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTGTGA
Genomic Sequence Data (6403 bps)
AAAAATTCCTGGAGGTTGTAACCCAGAAAATCCTGAAGGATGCCATATAATTGATGACCTCATCTATCCATGAGGCTGCT
CAGAAATGCCCACCCCTGGCCAGGCGCGGTGGCTCATGCCTGTAATCCAAGCACTTTGGGAGGCTGAGGCAGGCAGATCA
CGAGGTCAGGAGTTCAAGACCAGCGTGGCCAACATAGTGAAACTCTGTCTCTACTAAAAATACAGAAATTAGCCGGGCAT
GGTGGCAGGCACCTGCAGTCCCAGCTACTTGGGAGGGTGAGGCAGGAGAATCGCTTGAACCCGGGAGGCAAAGGTTGCAG
TGAGCCGAGACCATGCCATTGTACCTCAGCCTGGGTGACAGAGTGAGACTACGTCTCGAAAAATAAAGAAAAAGAAAAGA
AAAAGAAAAAAAAAGAAAAATTCCCATCCCTTTTGCGAATGGCAGACATGCACACACCAGAGAAGATTCCAATTTAGTGT
CTTCCCTCTCTTCATAGAACAATTCCTCAAGTCCACTCTGAGTAGAGGCTGCATCACAACAAGGGGATTGCCCTGTCTCC
TTCCAGGGCTCTTAATAGAAACTCTTCAACTAGTAACTGAGATGTCACCATGGGGGATTTTTCTAATTGGCCAAAACCTG
ACTTGGCAGGGTTTGGTTTGGGTGTCTTCAGATTTCCTTGTCTTGAGGTCCTCACAATTACTCTACAGCTCAGAACAGCA
ACTGCTGAGGCTGCCTTGGGAAGAAGATGATCCTAAACAAAGCTCTGATGCTGGGGGCCCTCGCCCTGACCACCGTGATG
AGCCCTTGTGGAGGTGAAGACATTGTGGGTGAGTGCGTGAGTGAGGAATGTTCTCTGGAGCTGAAAAACAGTAAATTGAA
GGAAAAGAGAGAAAGCGATTTGCAGAGAAATTGTAGAGATTTCCTAAGACCCCTTTCAGTATTAAGAGAATTAAAAATTA
TAGCTGTTCCTCCTTCAGGAAACCAGAGCCCCAACCTACTCTTTTTGTTATGTATGCTTTTGTGTTCACTAAGGATGCTA
TTCTGTTTATATTATATTCAGTGACTACAGCCTGGAGGTCTCTATGTCATTCCATCATGATTGCCTCAAAAATTAGTGAG
GTTTCCATCAGTGGATAATTTTTTATTATTAAAAATGTATGAAGTGTCATTCTCAAATTTCCCTGAACAACTTTTGAAGA
TTTTCGGATGTCTCCTGTAGTAGATCTTGGGGTCGTTCCATCAATTATATACTCTATAGATATTAAAAAAGTTGCCCGTT
TCTTTCTCTCAGACTTACTCACATTTCCACATGGGAACTGGCACAGGTGGGGAGTAGGTAAAGGAGTCCAGCAGGCTGAA
TGCCTTCAACAATCATTTTACCACATGGTCCTCACTTACTCTCAGCTGCCTCATATGTGTCACCTCACAAATAATCAAAT
AAAATGGGCATGTAGCTAAGCTTTGTAAATAGTGAAAACATGGATGTCAATTGTTTTTACATATTTCTATTACAGGTATA
GCTTCACATTTCTTTTCTTTAGCAAAATAAGGGATCCTTTTAGTTTAAAATTGAGAAGTAGAAAAAATTGGTAAATTAAA
TCATTTTATTCTCAAATTATCAACCCAAATTACCTGTTCTTCACCTCATCTAATAAAGTCCTATAAAAAGAAAAGTGGGC
CAGACATGGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCGAAGCAGGAGGATCATTTGAGCCTGGGAGTTTGAG
ACCAGCCTGGGCAACACAGCAAGACCTCATCTCTACCAAAAAATAAAATAAAAATTAGCCAGGCATGGTAGTGCATGCCT
GTGGTGCCAGCTACTCAGAAGGCTGCAGTGGGAGGAGCACTTGAGTCCAGGAGGTGGAAGCTGCAGTGAGCCATGATGGC
ACCACTACACTCCAGCCAGGGCAACAGAGAGAGACCCTGTCTCAAAAAGAAAGCGGAAAGAAAGAGAGAAAGGAAGGAAA
GAAGGAAAGAAGGAAGCAAGGAAGGAGAAAGGGAAGGGAAGAAAGAAGAAAGAAAGAAAGAAAACAGAAGGAAGGAAGCA
CAGATTAATTATTTGGTCTCTTAGTCTCCTCTGCCTTTGTCGTCCATCTCTTCCCACCTCTCTTCATGCATTCCTTTCTC
CCTCTTCCCTTTCAGGATCCATCTCTGACTCCCTGCTCCTTTATAGAGATGGACATGAGTTTGTAAAACAAAAGTTGAAA
AGTCAGATAGTTAAAAGGGGAAGTAAACTGGAAGGTACTCTAAACTTTCACAACCTTATTAACCGTGGCAGCTCCCATTC
TGATTTTGTTCAGCAGTGGAAGTTTCACCCTCTCCTCCAGAGCGCTTGGCTTCTTTGTTCCAAATTTCCTTTCTTCAGCC
TCACACCAGAGTGCCCTGGTCAGGCTCAGCTCATCCATTAGGCACAATGTGGGCAGTGCAGGGGAACCTCCATACTGTAA
AGCCACATGAGAATGTTTTAACTCCTTTTAAAATTATAAAAAAATGAAATTGTAGAGCCTAAGAAAATGTTTTAACTTTT
AATTCAGCCTATATTATATTGTCTTTATACCAATTCAGTCATAAAATATAATTTTCCATATTTTTATGGAGGAAGGCGTC
CACACAAGCAAGAGTGCTTGGGGCTCACATGTCAGAACGCATCCCTGATCATGGCTGATCCTGACCTTCGTGTGGTTCTG
CTAACTATGTGCCTGTCAGTCTTCCCCAAAATCTATGTGGTCCTCAAATATAACAACTGTCATTCAATACACATGTTTGA
GCACCCAGTGAGCTAAGTTTTAAGGATTCAAAGATGAAAAGTCATGCTGTCTCCCCTGCAGAGGGTGCTCAGACTAGTGA
TGGAAACAGTATGGGATGAAAGAAAGCAGAAGGCCATTGCTGAGCAGGCAGTGGACTCAGCAGAGGCTGAAACTATACAA
GTGACTTGGTTCCAGCTGGGCCAGCAGGATAACCAGACGAAAAGAAGGATTGCATATATTCCATATATATTTATGTTTGA
ACAAAGAGTCAAGGTTTATTGCAAGGATAAGGAGGCTTTGTTGGTGGCCTGTTAAGACCATCCAGCGTGGTCATACTGGA
TAGGGAAGAAGGTGAGCTGGAAGAGGGATAGACAAACTTGGATGGCCAGATGTTGAGATGGAGGAGCTGGAGGTCATAAC
GTGGTCAAAAACATGTTGATGAGAGGACTTAGCTACAAAGTTGTTAACTTAAGCAGAAACCTCAAGGATTGATTTTATGA
TTTCTCCAGGAAGTCCTAAAAGATAATTTCATTTCAGGGAGGAAAACAACAGACCACTGCAAAGACCAGGAACATGAAAG
GATAATGTAGTTTGGTTTGCTTGGCAGATACTTGTGAAAGATGTTGGACTGTAAGGCTGTCAATATCCTCCTCGCAGAAC
TTACTACAGTACATTGTATCTGCTCCCTTACCTACCTGACTCTCCCACTATTCAGTTTGTTCCTTAATGGTAGACCATGC
CTGATTGGTGTTTTACACTTCCCCTGCTATGTCTGATACTTGTGGATGCTCAGAAAGTGGGGAAGGAAGGAAAGATACGA
TGGTAAAAGGCTTACACATGTCTTGACCAGAATGTTCAGTTTGGCTCATTTGGCTGGAGTCATACTGCATGGCTGCCATT
CTGCTCTGGCATCCTCAGAGAAGCACACTGCCCATTAGAGGAAAAAGGGTGAATATAAATGTTGAGTCAGAACACTGCAG
ACATTTAGTAACCTCCTTCAGAGGAAAAAAAGGGTGGGGGGAATGACAGAAATCCAAAAACTAGTAGAGCTTCCACTTTT
TCATTTCAGAAGAAATCAGTTACTCTCCTCTAAGGACCATTACTATTAACAAAACAGAGACCTTAGAAGGAAGCATTATT
TATTTATCATATATTTTGTAATGTTATTACCGTTCTTGTTATACTCTTTCTTATACCCTACCATTGTTAGCAGAAATTAT
TTTAAATTAATAAGATCCTGCATGCTTTTCCTTTTTCTAAAAAAAGAAAGATCTCTGTGTAGAATGTCCTGTTCTGAGCC
AGTCCTGAGAGGAAAGGAAGTATAATCAATTTGTTATTAACTGATGAAAGAATTAAGTGAAAGATAAACCTTAGGAAGCA
GAGGGAAGTTAATCTATGACTAAGAAAGTTAAGTACTCTGATAACTCATTCATTCCTTCTTCTGTTCATTTACATTATTT
AATCACAAGTCCATGATGTGCCAGGCACTCAGGAAATAGTGAAAATCGGACACGCGATATTCTGCCCTTGTGTAGCACAC
ACTGTAGTGGGAAAGAAAGTGCACTTTTAACTGGACAACTATCAACACGAAGAGGGGAGGAAGCAGGGGCTGGAAATGTC
CACAGACTTTGCCAAAGACAAAGCCCATAATATTTGAAAGTCAGTTTCTTCCATCATTTTGTGTATTAAGGTTTTTTATT
CTCCTGTTCTCTGCCTTCCTGCTTGTCATCTTCACTCATCAGCTGACCACGTTGCCTCTTACGGTGTAAACTTGTACCAG
TCTTACGGTCCCTCTGGCCAGTTCACCCATGAATTTGATGGAGACGAGGAGTTCTATGTGGACCTGGAGAGGAAGGAGAC
TGTCTGGAAGTTGCCTCTGTTCCACAGACTTAGATTTGACCCGCAATTTGCACTGACAAACATCGCTGTGCTAAAACATA
ACTTGAACATCCTGATTAAACGCTCCAACTCTACCGCTGCTACCAATGGTATGTGTCCACCATTCTGCCTTTCTTTACTG
ATCTATCCCTTTATACCAAGTTTCATTATTTTCTTTCCAAGAGGTCCCCAGATCTTCTCATGGCAATTGCTGAAATTTTA
TCATTTCTCATCTCTAAAATCACATATCCCCATGTAATACAAGGGTCTTTCCATTATGCATTCATTAAATCATTCTAGGA
GAGGTCTCATCAACCTCCTACTTTATTAAACATGCCCACAGAGAGAAGGGCACAGGAGTAAAGCAGAGGCAATGTGTCAT
TGCTCCCAAGTAGAAGGTAAATAAGGCCTCTTTGACCAGCAGGAGAGGAAATGCTGGTAGGAAGACTCTTCCAGGATGTA
ATGCAGAAGCTCAGGGCAGAGCTATTCACACTTCACACCAGTGCTGTTTCCTCACCATAGAGGTTCCTGAGGTCACAGTG
TTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACACCCTCATCTGTCTTGTGGACAACATCTTTCCTCCTGTGGTCAA
CATCACCTGGCTGAGCAATGGGCACTCAGTCACAGAAGGTGTTTCTGAGACCAGCTTCCTCTCCAAGAGTGATCATTCCT
TCTTCAAGATCAGTTACCTCACCTTCCTCCCTTCTGCTGATGAGATTTATGACTGCAAGGTGGAGCACTGGGGCCTGGAT
GAGCCTCTTCTGAAACACTGGGGTAAGGATGAGTTTCACCATTTTTTGATGCTTTCTTGTCTGTCAAGTTCAGAACTTCC
TGCCTTTTACTCTATGTCCCAAAACTTGTTTTCCACACTTCATGAGTTTCTTTTATCTTTTTTTTTTTTTGAAAGAATTA
AGCAACAAAAGCACAGATTTATTAAAAAAGAAAGTACACTCCACAGGGTGGGAGCAGGCCTGCCACTTCATGGGTTTCTA
ATAACAGACTTCACTCTCCTCCCTGAGCCAGGGGCCTTGAGTCTTTGCAGAGCCAACCCTCCACCCCATCCCATCCCTCA
CACATGCACATGAGCACACTCTGCATTCTGACCTCAACAACTTCACTTCCACAGAGCCTGAGATTCCAGCACCTATGTCA
GAGCTCACAGAGACTGTGGTCTGTGCCCTGGGGTTGTCTGTGGGCCTCGTGGGCATTGTGGTGGGGACCGTCTTGATCAT
CCGAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCCTTGTGAATCCCATCCTGAAAAAGAAGGTAAGTTTGAG
ATTTGTTAGAGCTGAAGCTGCAGGAAGGAAAGTGGGAGGAGGCTGTGGACATGAATGTGGTTGAAAGTTGTAGGGGAATT
GGGAAGTGGCATGATGATGACACAGGAGCCCCCTTGGACCCATCGATCTCATGTCTGTCCTGTTGCAGGTGCATCACCAT
CTACAGCAGCGGAAGAGTGGACTTGCTACATGACCTAGCACTATTCTCTGGCCCGATTTATCATACCCTTTTTCTCCTGC
AAATGTTTCTCCTCTTACCTTTTCTCTGCTTTTTTTTCCTTAAGCTTCTGTATCCCCTCAGAGCTCACAAATGCCTTTGA
ATTCTTTCCCTGACCTCCTGATTTTTTTTTCTTTTCTCAGGTGTTACCTACTAAGAGATGCCTGGGGTAAGCCGCCCAGC
TAC

IMGT/HLA

Sponsors

Animated Sponsors Logo