Allele Report for DQA1*01:02:01:01

DQA1*01:02:01:01 View HGVS Report
Pre-2010 Nomenclature: DQA1*010201 Local Names: DQA1*01021, HB20, DQA 1.2 (DQA6), DQA 1.2
IMGT/HLA Acc No: HLA00602 OMIM Entry: *146880
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: AL662789 , AY663406 , L34083 , L46875 , M20431  
Cells Sequence Derived From: AZH , CMCC , DRA , EMJ , LB , NA10923 , PGF , ROF-NL , WT46  
Known Ethnic Origin Of Source: Caucasoid
Publications
Horn GT et al. Proc Natl Acad Sci U S A 85:6012-6 1988. (View abstract)
Raymond CK et al. Genome Res 15:1250-7 2005. (View abstract)
Todd JA et al. Nature 329:599-604 1987. (View abstract)
Lock CB et al. Immunogenetics 27:449-55 1988. (View abstract)
Auffray C et al. Nature 308:327-33 1984. (View abstract)
Horn GT et al. Hum Immunol 21:249-63 1988. (View abstract)
Yasunaga S et al. Tissue Antigens 47:37-48 1996. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 9 Laboratories: 7
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (255 aa)
MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGF
DPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSE
TSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGPL
Nucleotide Sequence Data (768 bps)
ATGATCCTAAACAAAGCTCTGCTGCTGGGGGCCCTCGCTCTGACCACCGTGATGAGCCCCTGTGGAGGTGAAGACATTGT
GGCTGACCACGTTGCCTCTTGTGGTGTAAACTTGTACCAGTTTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGATG
GAGATGAGCAGTTCTACGTGGACCTGGAGAGGAAGGAGACTGCCTGGCGGTGGCCTGAGTTCAGCAAATTTGGAGGTTTT
GACCCGCAGGGTGCACTGAGAAACATGGCTGTGGCAAAACACAACTTGAACATCATGATTAAACGCTACAACTCTACCGC
TGCTACCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACACCCTCATTTGTC
TTGTGGACAACATCTTTCCTCCTGTGGTCAACATCACATGGCTGAGCAATGGGCAGTCAGTCACAGAAGGTGTTTCTGAG
ACCAGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCTTCCTCCCTTCTGCTGATGAGATTTA
TGACTGCAAGGTGGAGCACTGGGGCCTGGACCAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCCCCTATGTCAG
AGCTCACAGAGACTGTGGTCTGTGCCCTGGGGTTGTCTGTGGGCCTCATGGGCATTGTGGTGGGCACTGTCTTCATCATC
CAAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCATTGTGA
Genomic Sequence Data (6484 bps)
AAAAATTCCTGGAGGTTGTAAGCCAGAACATCCTGAAGGATGCCGTATAACTGATGACCTCATCTATCCACGAGGCTGCT
CAGAAATGCCCACCCCTGGCCAGGCGCGGTGGCTCATGCCTGTAATCTGAGTACTTTGGGAGGCTGAGACGGGCAGATCA
TGAGGTCAGGAGTTCAAGACCAGCGTGGCCAACATAGTGAAACCCCGTCTCTACTAAAAATACAAAAATTAGCTGGGCGT
GGTGGCAGGTGCCTGCAGTCCCAGCTACTTGGGAGGGTGAGGGAGGAGAATCGCTTGAATCCGGGAGGCAAAGGTTGCAG
TGAGCCGAGACCTTGCCATTGTACCTCAGCCTGGGTGACAGAGTGAGACTACGTCTCAAAAAAAAAGAAAAAGAAAAGAA
AAAGGAAAAAAAAGAAAAACACCCATCCCTCTTGCGACTGGCAGACATGCACACACCAGAGAAGATTCCAATTTAATGTC
CTCCCTTTATTCATAGAACAATTCCTCAAGTCCACTCTGAGTAGAGGCTGCATCACAAGGGGATTGCCCCGTCTCCTTCC
AGGGCTCTTAATACAAACTCTTCAACTAGTAACTGAGATGTCACCATAGGGGATTTTTCTAATTGGCCAAAACCTGACTT
GGCAGGGTTTGGTTTGGGTGTCTTCAGATTTCCTTGTCTTGAGGTCCTCACAATTACTCTACAGCTCAGAACACCAACTG
CTGAGGCTGCCTTGGGAAGAGGATGATCCTAAACAAAGCTCTGCTGCTGGGGGCCCTCGCTCTGACCACCGTGATGAGCC
CCTGTGGAGGTGAAGACATTGTGGGTGAGTGCATGAGTGAGGGATGTTCTCTGGAGCTGAAAAACAGTAAATTGAAGGAA
AAGAGATAAAGCGATTTGCAGAGAAACTGTAGAGATTTCCTAAGGGCCCTTTCAGTATTAAGACAATTAAAAATTATAGC
TGTTCCTCCTTCAGGAAACCAGAGCCCCAACCTACTCTTTTTGTTATCTATGCTGTTGTGTTCACTAAGGACGCTATTCT
GTTTATATTATATTCAGTGACTACGGCCTGGAGGTCTCTATGTCGTTCCATCATGATTGCCTCAAAAATTAGTGAGGTTT
CCATCAGTGGATAATTTTTTATTATTAAAAATTTATGAAGTGTCATTCTCAAATTTCCCTGAACAACTTTTGAAGCTTTT
CGGATGTCTCCGGTGGTAGATCTTGGGGTCATTCCATCAATTATGTACTCTATAGATATTTAAAATGTTGCCCGTTTCTT
TCTCTCAGACTTACTCACATTTCCACATGGGAACTGGCACAGGTGGGGAGTGGGTAAAGGAGTCCAGCAGGCTGAATGCC
TTCAACAATCATTTTACCACATGGTCCTCACTTACTCTCAGCTGCCTCATATGTGTCACCTCACAAGTAATCAAATAAAA
TGGGCATGTGGCTAAGCTTTGTAAATAGTGAAAACATGAATGTCAATTTTTTTTACATATTTCTATTACAGATATAGCTT
CACATTTCTTTTCTTTAGCAAAATAAGGGATCATTTTATTTTAAAATTGAGAAGTAGAAAAAATTGGTAAAATAAATCAT
TTTATTCTCAAATTATCAACCCAAATTACCTGTTCTTCACCTCATCTAATAAAGTCCTATAAAAAGAAAAGTGGGCCAGA
CAAGGTGGCTCATGCCTGTAATCCCAGCACTTTGGGAGGCCGAGGCAGGAGGATCATTTGAGCCTGGGAGCTTGAGACCA
GCCTGGGCAACATAGCAAGACCTCATCTCTACAAAAAAAGAAAAATAAAAATTAGCCAGGCATGGTGGTGTGTGCCTGTG
GTGCCAGCTACTCAGAAGGCTGCCGTGGGAGGACCACTTGAGTCCATGAGGCGGAAGCTGCAGTGAGCCATGGTGGCACC
ACTACACTCCAGCCAGGGCAACAGAGAGAGGCGCTGTCTCAAAAAGAAAGAGGAAAGAAAGCGAGGAAGGAAGGAAGGAA
GGAGAAGGAAGGAAGGAAGGAAAAGAAAAGAAAAGGGAAGGGAGGAAGGAAGGGAAAAAGAAAGACAGAAAGAAAGAGGA
AGGAAGGAAGAAAGGAAGCACAGATTAATTATTTGGTCTCTTACTCTCCTCTGCCTTTGTCGTCCATCTCTTTCCACCTC
TCTTCATGCATCCCTTTCTCCCTCTTCCCTTTCAGGATCCATCTCTGACTCCCTGCTCCTTTATAGAGATGGACAGTGGG
TTTGTAAAACAAAAGTTGAAAAGTCAGATAGTTAAAAGGGGAAGTGAACTGGAAGGTACTTTAAACTTTCACAACTTTAT
TAACCGTGGCTGCTCCCATTATGATTTTGTTCGGCAGTGGAAGTTTCACCTGCTTCTCCAGAGCGCTTGGCGTCTTTGTT
CCAAATTTCCTTTCTTCAACCTCACACCAGAGTGCCCTGGTCAGGCTTGGCTCATTCATTAGGCACAATGTGGGCAGTGC
AGGGGACCCTCCATACTGTAAAGCCACATGAGAAGGTTTTAACTCCTTTTAAAATTAGAAAAATAATGGAATATTAGAGC
CTAAGAAAATGTTTTAACTTTTAATTCAGCCTAGATTATATTGTCTTTATACCAATTCAGTCATAAAATATAATTTTCCA
TATTTTTGTGGAGGAAGAGGCCCATACAAGCAAGAATGCTCGGGGCTCACATGTCAGAATGCAGCCTTGGTCATGACTGA
TCCTGGCCTTCGTATGGTTCTGCTACCTGTGTGCCTGCCCGTCTTCCCCAAAATCTATGTGGTCCTCGAATATAGCAACT
GTCATTCAATACACATGTTTGAGCACACAGTGAGCTAAGTTTTAAGGATTCAAAGATGAAAAGTCATGCTGTCTTCCCTG
CAGAGGGTGCTCAGATTAGTGATGGAAACAGTATGGGGTGCAGGAAAGCAGAAGGCCATTGCTGAGCAGGGCAGTGGACC
CAGCAGAGGCTGAAACAATACAAGTGACTTGGTTCCAGGTGGGCCAGCAGGGTGACGTCCTCTAGCAAAATTTGGCACCC
AAGACAAGTACCAGAAGAAAAGAAAGACTGCATGTATTCCACATATATTCATGTTTGAACAAGGAGTCAAGATTTATGGC
AAGGATAAGGAGGCTTTGTTGGTGACCTGTTAAGACCAACCAGGGCAGTCATGCTGGATAGGGAAGAAGGTGAGCTGGAA
GAGGAACAGACAACTTGGACAGCCAGATGTTGAGACGGAGGGGTTGGAGGTCATAATGTGGTCAAAAACATGTTGATGAG
AGGACTCAGCTACAAAGTTGTTAACTTAAGCAGAAACCTCAAGGATGGATTTTAGAATTTCTCCAGGAAGTCCTAAAAGA
TAATTCCATTTCAGGGAGAAAAACAACAGACCACTGCAAAGACCAGGGAACATGAAAGGATAATGTAGTTTGTCTTGCTT
GGCAGATACTTTTGAAGGATGTTGGACTGTAAGGCTGTCGATATCCTCCTCAGAGAACTTACTACAGTACATTGTATCTG
TTCCCTTACCTACCTGACTCTTCCACTATTCAGTTTGTTCCTTAATAGTAGACCATGCCTGATTGGTGTTTTACACATCT
CCGGCTATGTCTGACACTTGTGGATGCTCAGAAAGTGGGGAAGGAAGGAAAGATACGATGGTAAAAGGCTTACACATGTC
TTGACAAAAAAGTCCAGTTTGGCTCATTTGGCTGGAGTCGTACTGCATGGCTGCCATTCTGCTCTGGCATCCTCAGACAA
GCACACTGCCCATTAGAGGAAAAAGTGTGATATAAGTGTTGAGTCAGAATGCTGTAGACATTTAGTAATCTCCTTCACAG
GAAAAAAAAAAAAAAGGTGGGGGGAATGACAGAAATCCAAAAACTAGTAGAGCTTCCACTTTTCATTTCAGAAGAAATCA
GTTGCTCTCCTCTAAGGACCATTACTATTAACAAAACAGAGACCTTAGAAGGAGGCATTGTTTATTTATTATATATTTTG
TAATGTTATTACCAATCTTGTTATACTCTTTCTTATACCCTACAATTGTTAGCAGAAATTATTTTAAATTAATAAGATCC
TGCATGCTTTTCCTTTAAAAAAAAAAAAAAGAAAGATCTCTGTGTAGAGTGTCCTATTCTGAGCCAGTCCTGAGAGGAAA
GGAAGTATAATCAATTTGTTATTAACCAATGAAAGAATTAAGTGAAAGATAAATCTCAGGAAGCAGAGGGAAGTAAACCT
AATTTCTGACTAAGAAAGCTAAATACTATGATAACTCATTCATTCCTTCTTTTGTTCAATTACATTATTTAATCATAAGT
CCATGACATGCCAGGCACTCAGGAAATAGTAAAAATTGGACATGCGATATTCTGCCCTTGTGTAGCGCACACTAGAGTGG
GAAAGAAAGTGCACTTTTAACTGGACAACTACCAACATGAAGAGGGGAGGAAGCAGGGGCTGGAAATGTCCACAGACTGT
GCCAAAAAATGAAGCCCATAATATTTGAAAGTCAGTTTCTTCCATCATTTTGTGTATTAAGGTTCTTTCTTCCCCTGTTC
TCCGCCTTCCTGCTTGTCATCTTCACTCATCAGCTGACCACGTTGCCTCTTGTGGTGTAAACTTGTACCAGTTTTACGGT
CCCTCTGGCCAGTACACCCATGAATTTGATGGAGATGAGCAGTTCTACGTGGACCTGGAGAGGAAGGAGACTGCCTGGCG
GTGGCCTGAGTTCAGCAAATTTGGAGGTTTTGACCCGCAGGGTGCACTGAGAAACATGGCTGTGGCAAAACACAACTTGA
ACATCATGATTAAACGCTACAACTCTACCGCTGCTACCAATGGTATGCGTCCACCATTCTGCCTCTCTTTACTTAAGTTA
TCCCTCCATACCAGGGTTCATTATTTTCTTCCCAAGAGGTCCCCAGATCTTCTTATGGCAATTGCTGAAATTTTATCATC
TCCCATCTCTAAAATCACATATTCCCATGTAATACAAGGGTCTTTCCATTATGCATTCAGCAAATCCTTCTAGGAGAGGT
CTCATCAACCTCCTACTTTATTAAACATGCCCACAGAGAGAAGGGCACAGGAATAAAGCAGAGGCAATGTGTCGTTGCTC
CCAAGCAGAAGGTAAATAAGACCTCTTTGACTATCAGGTGGTGAAATGCTGGTAGGAGGGCTCTTCCAGGATGTAATGCA
GAACTTCAGGGCAGAGCTATTCACACTTCACACCAGTGCTGTTTCCTCACCACAGAGGTTCCTGAGGTCACAGTGTTTTC
CAAGTCTCCCGTGACACTGGGTCAGCCCAACACCCTCATTTGTCTTGTGGACAACATCTTTCCTCCTGTGGTCAACATCA
CATGGCTGAGCAATGGGCAGTCAGTCACAGAAGGTGTTTCTGAGACCAGCTTCCTCTCCAAGAGTGATCATTCCTTCTTC
AAGATCAGTTACCTCACCTTCCTCCCTTCTGCTGATGAGATTTATGACTGCAAGGTGGAGCACTGGGGCCTGGACCAGCC
TCTTCTGAAACACTGGGGTAAGGATGAGTTTCATCATTTTTTGATTCTTTCTTGTCTGTCAAGTTCAGAACTTCCTGCCT
TTTACTCCTATATCCAAAAACTTGTTTTCCACACTTCATGGGTTTCTTTTCTGTCTCTCTTTTTTTTTTGAAAGAATAAA
GCAAAAAAAGCAGAGATTTATTGAAAATGAAAGTACACTCTACAGGATGGGAGTGGGCCTGCCACTTCATGGTTTTCTAA
TGATAGACTTCACTCTTCTCCCTAAGCCTGGGGCCTTGAGTCTTTGCAGAGCCAACCCTCTACCCCATCCCATCCCACAC
ACATGCACATGAGCACACTCTGCATTCTGACCTCAACAACTTCACTTCCACAGAGCCTGAGATTCCAGCCCCTATGTCAG
AGCTCACAGAGACTGTGGTCTGTGCCCTGGGGTTGTCTGTGGGCCTCATGGGCATTGTGGTGGGCACTGTCTTCATCATC
CAAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCATTGTGAATCCCATCCTGGAAGGGAAGGTAAGATTGAGA
CTGGTTACAGTTGAAGCGGCAGTATGAAAGGAAGGAAAGTGGGAGGGCGTTGTGGACATGAATGTGGTTGAAAGTTGTAG
GGGAATTGGGAAGTGGCATGATGATGACACAGGAGCCCCCTCGGACCCATTGATCTCATGTCTGCCCTGTTGCAGGTGCA
TCGCCATCTACAGGAGCAGAAGAATGGACTTGCTAAATGACCTAGCACTATTCTCTGGCCCGATTTATCATATCCCTTTT
CTCCTCCAAATATTTCTCCTCTCACCTTTTCTCTGGGACTTAAGCTGCTATATCCCCTCAGAGCTCACAAATGCCTTTAC
ATTCTTTCCCTGACCTCCTGATTTTTTTTTTCTTTTCTCAAATGTTACCTACAAAGACATGCCTGGGGTAAGCCACCCGG
CTAC

IMGT/HLA

Sponsors

Animated Sponsors Logo