Allele Report for DQA1*01:02:03

DQA1*01:02:03
Pre-2010 Nomenclature: DQA1*010203 Local Names: BM3171
IMGT/HLA Acc No: HLA02338 OMIM Entry: *146880
Assigned: 2005-09-23 Sequence Last Modified: 2006-01-12
Source Entries: DQ178400 , DQ178401 , DQ178402 , DQ178403  
Cells Sequence Derived From: BM3171  
Known Ethnic Origin Of Source: Oriental
Publications
Lee KW et al. Tissue Antigens 68:167-72 2006. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (255 aa)
MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYVDLERKETAWRWPEFSKFGGF
DPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSKSPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSE
TSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGPL
Nucleotide Sequence Data (768 bps)
ATGATCCTAAACAAAGCTCTGCTGCTGGGGGCCCTCGCTCTGACCACCGTGATGAGCCCCTGTGGAGGTGAAGACATTGT
GGCTGACCACGTTGCCTCTTGTGGTGTAAACTTGTACCAGTTTTACGGTCCCTCTGGCCAGTACACCCATGAATTTGATG
GAGATGAGCAGTTCTACGTGGACCTGGAGAGGAAGGAGACTGCCTGGCGGTGGCCTGAGTTCAGCAAATTTGGAGGTTTT
GACCCGCAGGGTGCACTGAGAAACATGGCTGTGGCAAAACACAACTTGAACATCATGATTAAACGCTACAACTCTACCGC
TGCTACCAATGAGGTTCCTGAGGTCACAGTGTTTTCCAAGTCTCCCGTGACACTGGGTCAGCCCAACACCCTCATTTGTC
TTGTGGACAACATCTTTCCTCCTGTGGTCAACATCACCTGGCTGAGCAATGGGCAGTCAGTCACAGAAGGTGTTTCTGAG
ACCAGCTTCCTCTCCAAGAGTGATCATTCCTTCTTCAAGATCAGTTACCTCACCTTCCTCCCTTCTGCTGATGAGATTTA
TGACTGCAAGGTGGAGCACTGGGGCCTGGACCAGCCTCTTCTGAAACACTGGGAGCCTGAGATTCCAGCCCCTATGTCAG
AGCTCACAGAGACTGTGGTCTGTGCCCTGGGGTTGTCTGTGGGCCTCATGGGCATTGTGGTGGGCACTGTCTTCATCATC
CAAGGCCTGCGTTCAGTTGGTGCTTCCAGACACCAAGGGCCATTGTGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo