Allele Report for DPB1*98:01

DPB1*98:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*9801 Local Names: 19503
IMGT/HLA Acc No: HLA01762 OMIM Entry: *142858
Assigned: 2003-06-13 Sequence Last Modified: 2003-07-12
Source Entries: AJ563603  
Cells Sequence Derived From: 19503  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDILEEKRAVPDRMCRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACGTGCACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGACTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo