Allele Report for DPB1*97:01

DPB1*97:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*9701 Local Names: HLA - DPB1*05XX
IMGT/HLA Acc No: HLA01753 OMIM Entry: *142858
Assigned: 2003-06-13 Sequence Last Modified: 2003-10-15
Source Entries: AY033075  
Cells Sequence Derived From: 627-S3262  
Known Ethnic Origin Of Source: Caucasoid
Publications
Lapi S et al. Tissue Antigens 63:606-8 2004. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (88 aa)
ENYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVWEFRAVTELGRPEAEYWNSQKDILEEKRAVPDRMCRHNYELD
EAVTLQRR
Nucleotide Sequence Data (266 bps)
AGAGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACA
ACCGGGAGGAGCTCGTGCGCTTCGACAGCGACGTGTGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGAGGCGGAG
TACTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGA
CGAGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo