Allele Report for DPB1*94:01

DPB1*94:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*9401 Local Names: mch4376
IMGT/HLA Acc No: HLA01669 OMIM Entry: *142858
Assigned: 2002-10-25 Sequence Last Modified: 2003-04-17
Source Entries: AF549409  
Cells Sequence Derived From: MCH4376  
Known Ethnic Origin Of Source: Black
CWD v2.0 Status: Not defined
Publications
Luo M et al. Tissue Antigens 62:182-4 2003. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEKWAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGTGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo