Allele Report for DPB1*91:01

DPB1*91:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*9101 Local Names: DP14NEW
IMGT/HLA Acc No: HLA01475 OMIM Entry: *142858
Assigned: 2001-04-26 Sequence Last Modified: 2001-07-09
Source Entries: AY029777  
Cells Sequence Derived From: VTIS20927  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDLLEEKRAVPDRMCRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACGTGCACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGACTA
CTGGAACAGCCAGAAGGACCTCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo