Allele Report for DPB1*85:01

DPB1*85:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*8501 Local Names: HLA-DPB1*27new MGD
IMGT/HLA Acc No: HLA01162 OMIM Entry: *142858
Assigned: 1999-11-29 Sequence Last Modified: 2009-07-17
Source Entries: AF184168 , AF211979 , FN256254  
Cells Sequence Derived From: 173643 , MGD , UCLA212  
Known Ethnic Origin Of Source: Black
Publications
Rozemuller EH et al. Tissue Antigens 56:282-4 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
NYVYQLRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELDE
AVTLQHRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQ
GDVYICQVEHTSLDSPVTVEW
Nucleotide Sequence Data (546 bps)
AGAATTACGTGTACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCACCGAGTCCAGCCTAAGGTGAACGTTTCCCCCTCCAAGAAGGGGCCCCTGCAGCACCACAAC
CTGCTTGTCTGCCACGTGACAGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTGAATGGACAGGAGGAAACAGC
TGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACCCCCCAGC
AGGGAGACGTCTACATCTGCCAAGTGGAGCACACCAGCCTGGACAGTCCTGTCACCGTGGAGTGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo