Allele Report for DPB1*80:01

DPB1*80:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*8001 Local Names: DPB1
IMGT/HLA Acc No: HLA00599 OMIM Entry: *142858
Assigned: 1998-08-18 Sequence Last Modified: 2008-10-10
Source Entries: AF074845 , FM210785  
Cells Sequence Derived From: 18055285 , CC  
Known Ethnic Origin Of Source: Black
Publications
Steiner LL et al. Tissue Antigens 53:201-6 1999. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDILEEKRAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGACTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo