Allele Report for DPB1*50:01

DPB1*50:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*5001 Local Names: None
IMGT/HLA Acc No: HLA00569 OMIM Entry: *142858
Assigned: 1993-06-09 Sequence Last Modified: 2010-10-15
Source Entries: FR667950 , L17311  
Cells Sequence Derived From: 202229 , 202231 , DIEDE  
Known Ethnic Origin Of Source: Caucasoid ? German, Europe , Caucasoid
Publications
Moonsamy PV et al. Tissue Antigens 43:249-52 1994. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
NYVYQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDLLEEKRAVPDRVCRHNYELDE
AVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQ
GDVYICQVEHTSLDSPVTVEW
Nucleotide Sequence Data (546 bps)
AGAATTACGTGTACCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGACTA
CTGGAACAGCCAGAAGGACCTCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGGTATGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAGTCCAGCCTAAGGTGAACGTTTCCCCCTCCAAGAAGGGGCCCCTGCAGCACCACAAC
CTGCTTGTCTGCCACGTGACAGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTGAATGGACAGGAGGAAACAGC
TGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACCCCCCAGC
AGGGAGACGTCTACATCTGCCAAGTGGAGCACACCAGCCTGGACAGTCCTGTCACCGTGGAGTGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo