Allele Report for DPB1*41:01:01

DPB1*41:01:01
Pre-2010 Nomenclature: DPB1*410101 Local Names: DPB2.3
IMGT/HLA Acc No: HLA00560 OMIM Entry: *142858
Assigned: 1992-10-20 Sequence Last Modified: 2013-07-12
Source Entries: D13174 , KC763179  
Cells Sequence Derived From: 2013010402 , HT-HT  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Mizuki N et al. Tissue Antigens 41:259-62 1993. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEEERAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGAGTA
CTGGAACAGCCAGAAGGACTTCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo