Allele Report for DPB1*41:01:02

DPB1*41:01:02 View HGVS Report
Pre-2010 Nomenclature: DPB1*410102 Local Names: V603_DPB1_V1
IMGT/HLA Acc No: HLA03155 OMIM Entry: *142858
Assigned: 2007-11-30 Sequence Last Modified: 2008-01-11
Source Entries: EU153252  
Alignment of CDS Source Entries
DPB1*01:01:01
DPB1*41:01:02
Submission 1

Locus Reference
  Virtual entry for DPB1*41:01:02 
  Individual submission(s) 
Cells Sequence Derived From: TZ-V603  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.3155 (Allele OID)
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDFLEEERAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGAGTA
CTGGAACAGCCAGAAGGACTTCCTGGAGGAGGAGCGGGCAGTGCCGGATAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors