Allele Report for DPB1*119:01

DPB1*119:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*2202 Local Names: DPB1*new14like
IMGT/HLA Acc No: HLA03490 OMIM Entry: *142858
Assigned: 2008-09-30 Sequence Last Modified: 2008-10-10
Source Entries: FM211032  
Cells Sequence Derived From: JUST1407AN  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDLLEEKRAVPDRVCRHNYELNE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACGTGCACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGACTA
CTGGAACAGCCAGAAGGACCTCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGGTATGCAGACACAACTACGAGCTGAACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo