Allele Report for DPB1*201:01

DPB1*201:01 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DPB1_110498_00034, HIS_NEW_DPB1_110498_00048, HIS_NEW_DPB1_110498_00046
IMGT/HLA Acc No: HLA10363 OMIM Entry: *142858
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KC875992 , KC875999 , KC876001 , KF501550 , KF602032 , KF602035 , KF647818 , KF790878  
Cells Sequence Derived From: HG00006211 , HG00006212 , HG00006213 , HG00008309 , HG00008310 , HG00008311 , HG00008312 , HG00008313  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 8 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYVYQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRVCRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACGTGTACCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGGTATGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo