Allele Report for DPB1*190:01

DPB1*190:01 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DPB1_110504_00065, HIS_NEW_DPB1_110469_00002
IMGT/HLA Acc No: HLA10349 OMIM Entry: *142858
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KC603589 , KC904502 , KF220353 , KF220356 , KF263525 , KF291305 , KF291306 , KF535989 , KF577648 , KF602044 , KF647826 , KF673243 , KF695031 , KF882477 , KF882492 , KF882493 , KF882501 , KF882502 , KF976768 , KJ094081  
Cells Sequence Derived From: HG00006191 , HG00006192 , HG00008282 , HG00008283 , HG00008284 , HG00008285 , HG00008286 , HG00008287 , HG00008288 , HG00008289 , HG00008290 , HG00008291 , HG00008292 , HG00008293 , HG00008294 , HG00008295 , HG00008296 , HG00008297 , HG00008298 , HG00008299  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 20 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPAEEYWNSQKDILEEKRAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGAGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo