Allele Report for DPB1*189:01

DPB1*189:01 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DPB1_110519_00086, HIS_NEW_DPB1_110525_00095
IMGT/HLA Acc No: HLA10348 OMIM Entry: *142858
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KC991085 , KF015568 , KF036211 , KF905292 , KJ142208 , KJ535646 , KJ535662  
Cells Sequence Derived From: HG00006189 , HG00006190 , HG00008279 , HG00008280 , HG00009041 , HG00009042 , HG00009043  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 7 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDLLEEERAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGAGTA
CTGGAACAGCCAGAAGGACCTCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo