Allele Report for DPB1*172:01

DPB1*172:01 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DPB1_110504_00059
IMGT/HLA Acc No: HLA10326 OMIM Entry: *142858
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KC904491  
Cells Sequence Derived From: HG00006157  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo