Allele Report for DPB1*114:01

DPB1*114:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*1702 Local Names: None
IMGT/HLA Acc No: HLA02451 OMIM Entry: *142858
Assigned: 2006-02-22 Sequence Last Modified: 2006-07-14
Source Entries: DQ206450  
Cells Sequence Derived From: GZ7272  
Known Ethnic Origin Of Source: Oriental
Publications
Li M et al. Tissue Antigens 68:187-8 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYVYQLRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTELGRPEAEYWNSQKDLLEEKRAVPDRVCRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACGTGTACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGCTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGAGGCGGAGTA
CTGGAACAGCCAGAAGGACCTCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGGTATGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo