Allele Report for DPB1*167:01

DPB1*167:01 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-DPB1
IMGT/HLA Acc No: HLA10263 OMIM Entry: *142858
Assigned: 2013-09-30 Sequence Last Modified: 2013-10-11
Source Entries: KF557650  
Cells Sequence Derived From: 5711102248  
Known Ethnic Origin Of Source: Oriental
Publications
He YM et al. Tissue Antigens 83:299-300 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYVHQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDLLEEERAVPDRVCRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACGTGCACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGAGTA
CTGGAACAGCCAGAAGGACCTCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGGTATGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo