Allele Report for DPB1*166:01

DPB1*166:01 View HGVS Report
Pre-2010 Nomenclature: Local Names: T1D9_DPB1_V
IMGT/HLA Acc No: HLA10026 OMIM Entry: *142858
Assigned: 2013-08-31 Sequence Last Modified: 2013-10-11
Source Entries: JX524133 , KC959360 , KF560464 , KF673778 , KF951136 , KJ094084  
Cells Sequence Derived From: 7550801401 , HG00006181 , HG00008267 , HG00008268 , HG00008269 , T1D9  
Known Ethnic Origin Of Source: Oriental
Publications
Deng ZH et al. Tissue Antigens 83:298-299 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 6 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDLLEEERAVPDRICRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGACTA
CTGGAACAGCCAGAAGGACCTCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATATGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo