Allele Report for DPB1*166:01

DPB1*166:01 View HGVS Report
Pre-2010 Nomenclature: Local Names: T1D9_DPB1_V
IMGT/HLA Acc No: HLA10026 OMIM Entry: *142858
Assigned: 2013-08-31 Sequence Last Modified: 2013-10-11
Source Entries: JX524133 , KC959360 , KF560464 , KF673778 , KF951136 , KJ094084  
Alignment of CDS Source Entries
DPB1*01:01:01
DPB1*166:01
Submission 1
Submission 2
Submission 3
Submission 4

Locus Reference
  Virtual entry for DPB1*166:01 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: 7550801401 , HG00006181 , HG00008267 , HG00008268 , HG00008269 , T1D9  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.10026 (Allele OID)
Publications
Deng ZH et al. Tissue Antigens 83:298-299 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 6 Laboratories: 3
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEDYWNSQKDLLEEERAVPDRICRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGACTA
CTGGAACAGCCAGAAGGACCTCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATATGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors