Allele Report for DPB1*165:01

DPB1*165:01 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DPB1_110462_00039
IMGT/HLA Acc No: HLA09769 OMIM Entry: *142858
Assigned: 2013-06-26 Sequence Last Modified: 2013-07-12
Source Entries: KC592362 , KF220359 , KJ018016  
Cells Sequence Derived From: HG00005923 , HG00007122 , HG00008324  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NCLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPDEEYWNSQKDILEEERAVPDRMCRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTGCCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo