Allele Report for DPB1*112:01

DPB1*112:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*1502 Local Names: DACO41672AN
IMGT/HLA Acc No: HLA02403 OMIM Entry: *142858
Assigned: 2005-12-30 Sequence Last Modified: 2006-01-12
Source Entries: AM158320  
Cells Sequence Derived From: DACO41672AN  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (88 aa)
ENYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELG
GPMTLQRR
Nucleotide Sequence Data (267 bps)
CAGAGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTAC
AACCGGGAGGAGCTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGA
GTACTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGG
GCGGGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo