Allele Report for DPB1*13:01:02

DPB1*13:01:02
Pre-2010 Nomenclature: Local Names: HIS_NEW_DPB1_110334_00015
IMGT/HLA Acc No: HLA09721 OMIM Entry: *142858
Assigned: 2013-06-26 Sequence Last Modified: 2013-07-12
Source Entries: JX842728 , KC875990 , KF560452 , KF560455 , KF577637  
Cells Sequence Derived From: HG00005652 , HG00007121 , HG00007682 , HG00007683 , HG00007684  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYVYQLRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEERAVPDRICRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACGTGTACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTAACGGAGCTGGGGCGGCCTGCTGCGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATATGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo