Allele Report for DPB1*133:01

DPB1*133:01 View HGVS Report
Pre-2010 Nomenclature: Local Names: LUMC-DP81
IMGT/HLA Acc No: HLA06672 OMIM Entry: *142858
Assigned: 2011-03-22 Sequence Last Modified: 2011-04-08
Source Entries: FR839026  
Cells Sequence Derived From: 11d00511 , LUMC-DP81  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
NYVYQLRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEERAVPDRICRHNYELDE
AVTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQ
GDVYTCQVEHTSLDSPVTVEW
Nucleotide Sequence Data (546 bps)
AGAATTACGTGTACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATATGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAGTCCAGCCTAGGGTGAATGTTTCCCCCTCCAAGAAGGGGCCCTTGCAGCACCACAAC
CTGCTTGTCTGCCACGTGACGGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTGAATGGACAGGAGGAAACAGC
TGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACCCCCCAGC
AGGGAGATGTCTACACCTGCCAAGTGGAGCACACCAGCCTGGATAGTCCTGTCACCGTGGAGTGGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo