Allele Report for DPB1*110:01

DPB1*110:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*1302 Local Names: HLA-DPB1
IMGT/HLA Acc No: HLA02243 OMIM Entry: *142858
Assigned: 2005-06-25 Sequence Last Modified: 2005-07-12
Source Entries: DQ089022  
Cells Sequence Derived From: 4023005  
Known Ethnic Origin Of Source: Caucasoid
Publications
Moonsamy P et al. Tissue Antigens 74:268-270 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYVYQLRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEERAVPDRICRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACGTGTACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATATGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo