Allele Report for DPB1*04:02:01:01

DPB1*04:02:01:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*0402 Local Names: DPB4.2, DPw4b
IMGT/HLA Acc No: HLA00522 OMIM Entry: *142858
Assigned: 1989-08-01 Sequence Last Modified: 2005-01-12
Source Entries: AY831402 , CR759904 , M21886 , M23676 , M62327  
Cells Sequence Derived From: APD , BURKHARDT , FH1  
Known Ethnic Origin Of Source: Caucasoid
Publications
Reinders J et al. Immunogenetics 57:790-4 2005. (View abstract)
Bugawan TL et al. J Immunol 141:4024-30 1988. (View abstract)
Lair B et al. J Immunol 141:1353-7 1988. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 4
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (258 aa)
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTEL
GRPDEEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFL
NGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSMDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
Nucleotide Sequence Data (777 bps)
ATGATGGTTCTGCAGGTTTCTGCGGCCCCCCGGACAGTGGCTCTGACGGCGTTACTGATGGTGCTGCTCACATCTGTGGT
CCAGGGCAGGGCCACTCCAGAGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCC
TGGAGAGATACATCTACAACCGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTG
GGGCGGCCTGATGAGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAG
ACACAACTACGAGCTGGGCGGGCCCATGACCCTGCAGCGCCGAGTCCAGCCTAGGGTGAATGTTTCCCCCTCCAAGAAGG
GGCCCTTGCAGCACCACAACCTGCTTGTCTGCCACGTGACGGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTG
AATGGACAGGAGGAAACAGCTGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGGACCTTCCAGATCCTGGTGAT
GCTGGAAATGACCCCCCAGCAGGGAGATGTCTACACCTGCCAAGTGGAGCACACCAGCATGGATAGTCCTGTCACCGTGG
AGTGGAAGGCACAGTCTGATTCTGCCCGGAGTAAGACATTGACGGGAGCTGGGGGCTTCGTGCTGGGGCTCATCATCTGT
GGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGTTCAACGAGGATCTGCATAA
Genomic Sequence Data (11516 bps)
TAATCCCTGTAGATGGGCCAGCAGAATATTTGAGATCACCTTCAGAGCAAAGAAAACGCATAATCTCCCCAAACATCATG
ACTTATCTGACTGGTTAAAATGAGTATCACTGTCTTTCCTCCGTCATCTTAAGTGCATCACAGGCTTTATATTTTCAGAC
CTTTCATACTAACTTTCTGCCTAGTGAGCAATGACTCATACAAAGCTCAGTGTCCATTGGTTCTTTTCTCAGACTCTGTC
CAATCCCAGGGTCACAGAAGACTACTTGGGTTCATGGTCTCTAATATTTCAAACAGGAGCTCCCTTTAGCGAGTCCTTCT
TTTCCTGACTGCAGCTCTTTTCATTTTGCCATCCTTTTCCAGCTCCATGATGGTTCTGCAGGTTTCTGCGGCCCCCCGGA
CAGTGGCTCTGACGGCGTTACTGATGGTGCTGCTCACATCTGTGGTCCAGGGCAGGGCCACTCCAGGTAAGAGCCGAACT
GCCATTCTTGGAGGGTCTGGCTCAGGGAACAATTCCTAGGGGACGTTATCTTTAAGGGATCAAATTCTGAGACAGGCTGC
GGGGGCTCCTGCCCTAAGGCAGTGTCCTCTCTTCCCAGCTAGAGAAAGAGGTTCATCCCCTATAGGATAGCTTGCTACCC
TACTGGCCTATTCTCTCTCCAAGGACATGGGTACAGTAAACAGAGAGAGGTGCCCAGTGGTCAGTATGCTTGTCTTTGGG
GAAAATGGGACCAAGAGGTCCTGGATAACCTTGGACAGACAAGGTTTGCAGAGAGAGAAGTTGGCAAGTGCAGGCTCCTG
GGCGTGTTCATGTCTGCATCCAGCCTGGAGGGGACTCAGGCAGAGAGCCCTAAGCTGGAGTGTCCAGGCTCTGAGGATCA
CTGAGGATTCAGTGCTCACGAAGAATGCCTCTTATTCCCCAGGGTGGAGCAGGAGCCCACATCCCTTGGACAATTAAGGA
GAGAAGGGAGGGAGGGGGATAGGTTTTAGCCCCTGAAGGCATTCTCATTAAAGGTACTTCTCCCAGCCTCCCCAGAACTT
GGTTAGGGTACTAGAGTGGGTTGCGACTTGTAGGAAGAATGAGATGAGGTTGTGTGGGTGCATGACAGGGATTGAGTGTA
GGTTATCAGACAGCCAAGGAAGCAGTAACCAAGTGAAAAATCTCTTCTTCCTGCTGCCTCCCTGTGGCTGGTGTAATATT
ATGGCATCTATGATCCATTGTTTTTCTCTCAGGATACTCTCAGGATATTTCTTTTTATATATATATATACTTTAAGTTCT
AGGGTACATGTGCACAACGTGCAGGTTTGTTACATATGTATACATGTGCCATGTTGGTGTGCTGCACCCATTAACTCGTC
ATTTACATTAGGTATATTTCCTAATGCTATCCCTCCCCCCTCCCCCCACCCCACAACAGGCCCCGGTGTATGATGTTCCC
CTTCCTGTGTCCATGTGTTCTCATTGTTCAGTTCCCACCTATGAGTGAGAACATGTGGTCTTTGGTTTTCTGTCCTTGCA
ATAGTTTGCTGTGAATGATGGTTTCCAGCTTCCTCCATGTCCCTACAAAGGACATGAACTCATCCTTTTTTATGGCTGCA
CAGTATTCCATGGTGTATATGTGTGCATTTTCTTAATCCAGTCTATCACTGATGGACAGTTGGGTTGGTTCCAAGTCTTT
GCTATTGTGAATAGTGCCGCTATAAACATATGTGTGCATGTGTCTTTATAGCAGCATGATTTATAATCCTTTGGGTATAT
ACCCAGTAATGGGATGGCTGGGTCAAATGGTATTTCTAGTTCTAGATCCTTGAGGAATTGCCACAATGTCTTGAGATACC
ATCTCACACCAGTTAAAATGGCGATCATTAAAAAGTCAGGAAACAACAGGTGCTGGAGAGGATGTGGAGAAATAGGAACA
CTTTTACTCTGTTGGTGGGACTGTAAACTAGTTCAACCATTGTACTCTCAGGACATTTCTAGTCCAAATTTACACCAACA
CTCTGAGAGGAAGGACTGCAAAGTAGGTACCTTAGTTTTCCACTGACTTCCACTTTTCCTGCTTACACCCTTCCTCCTAG
ACCTCTCCACACCCCTCCTAGGACACACCTAAAAGGTACTGACATCATGTCACCTCCTCATCTTTCAGGGTAGCAAGGTT
GGAATCTCCTGAATACAGCCCCTCAAGCCCTAAAACCTCTTATCTATTACCTTGGGTTCATTGTCCAGGAAGGGGAGGAG
AACTTGAACTTGTAGTCACAGAAGGGTGCTGAGAACTAACCAGCAGGACGGCTCAGCCCTGGGAACTGCAGAGGGGTGAG
GCTGGGGAGAGAGGAGGCTGGAGCAGCACTGGTGACACTGAACAGTGTCAGGAGGAAGTGACGGATGCAGCGCCCCCATC
CCATAGGCAGAGCTGTCATGTGGGATGAGGGACAGTGTTGGGAGCCACCAAGGAAACCCAGAGGTGGGGGAGCAGAGAGC
AGAAGGGAGCATGTGATGCTGGACAGTGAAAGGGAGGACAGGCAAAGGCTGGGTTGAGGTTTGTAGGGGGAATGAGATGA
GGCAGTGGAGCCATGTGACAGGGACTGAGGGTAGATTACTGGAGCTCCCTGCGTAGAATGAATGTTCAATCAAAATTTGC
TGGAGGGAGAGCTGGAGCCATAGGGGAGTGGGTAAAGTGGGCAGGGCTGATTCCACAATTCCCTGCATGCTCCCCCAACT
CCACACACATCCCCAACCTCAAACAGGGCACAAGACCAAAGGGCTGAGGAGCCAGGCTATAGCTTAAAGAGGCTGGGGGA
GAAAAGCTTGGCTGAGACAACCCATAGGGAGCTAGAGGTTTTTAATATATCCTATTCTGAATAAGAGACGAATTCATTCA
GATCAGTGGTTTCAAACCGTGCTCTGGGCAACTCAATTGCTAAGGGTTCCACAAACAGGATAAAGTTTCTTATATACAAA
AAAAAATGAAGGTTTCAAATTACACCATAAAACCCCTCATTGCTTATGTCTACTTGGCAGGTAAAATTCCATTTCAAAAG
TTAAATGTACTTAAAAAATTACCTAAGACTGGGTAAATTAAAAAAATTAAATGTTGCAAAGAAAAAATTCAAAATTCTTA
TTCTTGAATGAAAAACGTTCTCTTACTGGTGATTGAGGAGGAGAAACAAAGACTAACAAATGAAAATGGGAGAATCCACA
CTCAGAGTGGGGCAACTGAACAGGCAGGGGCGGATGGATGGCAGAGGAGGAGGAATCTGGACTCAAGGAGCTGGGGGGCT
CTGGGCCTGGAATTTTAGGGTCTGGGGCCCAAGGCACCAGGAGAAGAGGCAGGTCAGGATATCTGAGTCAAGACCTGGGA
TCTTGCCTTAGCAATGACACTGGAGACTAAAGGTGGACTCCATGGTGCCCTTGAGCCCAGCCCTACCCCATCTCCACTAT
CCTCTGCCACCAGCTGTGCAACTTCTGCTGGGGGTGAGGTTAATAAACTGGAGAAGTTAATTTGTGGAGCATGAAACAGA
TGAGCAGAACAATCACAGCACCTTAATTTCCCCAGTGTGCCCAAGAACAGAGCAGGCCTGAAGATACTCAAACAGAAACA
AACATGTGCCGTGTCACTGATAATTCTGTGTAGACACACACCTGCCAGACACTGCTCATGGCACTCCCTAGGAAGAACAG
CATGTGGGAAAGGCTGCCAAAATTGTTCATGTAAAAATTACATCAATGCTGTCTTCCTCGGTGCTGCCTATGCAGCTGGC
AGCCATCTCTTCCTCCACATCATGGCCTCCCTCAGACTCCTCATGAAGGATAAGATCCTCAAAAAGAGGACCAACAAGTT
CATGAGGCACCAATCAGACTGAAATGTCAAAATTAAGCATAACTGGCGGAAACCCAGAGGTCTTAACAGTAGGGTTCGTA
GAAGGTCCAAGGGCCAGATCTTGATGCCCAACATTGCTTATGGGAGCAACAACAACAACAAAAAAAACATGCTGCCCAGT
GGCTTCCAGAAGTTTCTGGTCCACAGCCTCAAGGAGCTGAAAGTGCTGCTGATGTGCAACAAATCTTACTGTGCTGAGAT
CGCTCACAAAATTTCCTCCAGAACTGCAAAGTCATCATGGAAAGAGTCACCCAGCCGGCCATCAGAGTCACCAACCCCAG
TACCAGGGTGCACAGCTAAGAAAATGAGTAGAAAGTTCATGTCCACGTTTTGTGTGTAAATAAAACCATAAAAACTGCCA
AAAAAAATTACATCAATGCCTCTAAACCCAAAGGACTCTACCCCCACAGGTCCCTGGTTGTTGTGGTGATTTTCATTGTG
TAAAATACTTTCCACATCTTTTGACACCAAGTCTTTCTGCAGCCATGTTTGAAAATTAACTTTCAGGCTACAGAGTCTTT
CTTATACCAAAGTTGAAGAAAGTTTTAAGAAATATATTTCTACATCTCCTACATGCAAAACAACAGGAGCAAGTTGAGGA
ATTCTCAAGAAACTGGTCGAGAAGAGAGAGCGCTTAGCTATGGAAAAGAGAAAGAAGGAAGGGAGGGCTTCCTGGAGGAG
GTGGCATTTGAACCAGGACTGACATCAGGATGGAAATGTCAGTCAGGGAGTTAAGTAGGGGGAGCAGCTCCGCCCTCCAC
GTCCCCAGCTCCTCCCGCCCCTGTTTTTTCTCCCAGTGACCCCACGTGAAACGTCTCCGCCTCCTCCAGCCACCAGCAGA
AGGGACTGCCTTCCCCTCAGTGCTCGCCCCTCCCTAGTGATCACTCAGTGCCCCTGAGCTCATTCTTTTCAGTAAATTCT
CTCTCTGCGTGGTGAGAAAACAGGCCTGGAGAGGCTCTGCGACCCGCTTAGGACCACAGAACTCGGTACTAGGAAAACTC
CTATTTTAAAATCCAGCCCTGGGTGGGAAGATTTGGGAAGAATCGTTAATATTGAGAGAGAGAGGGAGAAAGAGGATTAG
ATGAGAGTGGCGCCTCCGCTCATGTCCGCCCCCTCCCCGCAGAGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCG
TTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAACCGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGA
GTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGATGAGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGG
CAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCGGGCCCATGACCCTGCAGCGCCGAGGTGAGTGAGGGCTT
TGGGCCGGCGGTCCCAGGGCAGCCCCGCGGGCCCGTGCCCAGGGCGCAGGAGCAGCCGGGTTGGCCTAAGGGACCTTAGT
GCCGGGCGGAAAGGGGACTTTGGGTTGGGGATTCATGGGGGGAGCCCATCTGGAGCTTGTCAGGGGAGCGAGCGCGGGGA
CCTGGACTGGGCTGAGCATGGAGTGAGGAGGACGAGAGCAGAGAGACCCCCGGGACTTCATCAGGCCTGGCAGCTGACTG
CATGTGGGGTGAAAAAAGGAAGCCACAGGACAGCGCACAAGGGTATGGTGTGGAGATGGAGGTGGAGATGGCACAGCAGG
CCACACAGAGAAGAAACCTACAGGGAGGTAGCTGGGTTTGAGGTGCTTGAGGGGCAGATGGGTGGTCTGATGGGCAGGTA
GACAGAAGGGTCTGCAGCCGGGGAGGAGACTGAGATACATGAGACCATCCAGGGAGAGGGGACCCAGGGGGAAGAGCAAA
GGACCGGATCCTGGGAACTGGACAGTTGTGATTTGGCCAAGACAGAAAAGCCTGTGAAAGAGACCAAAAAAACCCAAGTG
CAGTGTGAGGAGAGGCCCGCAGAGAAGAGTCTTGGAAGCTGAGGGGAGGTGACCTCAGCAGCACAGTGGACAGCGGTGCC
AGTGACTTGGGAAGGTCAGAAAACAGAAGATGGAAAGTGGGTTTGGAAACCAGGGAGACCTGGGGAGAGCAGGTTGGCCG
CAGCGGCAGGAGCTGGAATGGGAGGGGGTGCATGAGGCTGAGTGTGGCGCATCCTCCTCGGGGCTGAGATGGATTTTACT
TGTCTTGGGTTCCCCACGGCTGTCACAGGGCAGTGTCTCAGTTCATTCGTCTTTTTCCTTCAGGAAGTCTGGGTGTAAAG
GGATGGAGAGAGGTGAGGTGTGTGCAGTAAGAGGATTTCTCAAGGATGGGACAGGAAGGCCTTGGAGCTTTGGCTTCCTC
CTGTGAACTTGTGGGGTGGGGAGCCTGGTGCACCAACCTGAGGGACTTGAGGGAGTAGTATCAGGATGTGGGATTGAGCC
CTGGACCTTTTTTCTAGAAAGAGGAAAAAAATGAAGGGAGGAGGAGGAGGAAGCTGGGGAGATCACACCTTTGATTTTCT
TGTTCCTGGAAAGTGAAAGGAAGTTCACCTGCTATGAGTGAGAAGGTGGACACACTGGGTGGGGATGAGGTGAGTGACAT
GAGCTTAGGAAAGTTGCTGAGGTAATTGGTTGAGAGAGGTGTTCAAATAAAAATAACGCAATTGGCAAAAACTGTTACTA
AGACTTTGTAGAGGCACCAATCAGTGACATGGCAGCATTTTCTTTCACAGTAATCAACTGCCAGATTGCAGACAGCCCTG
ATGCCAGCCTAAGGAGTGTGGGTTTCTCCTCCAGGCCCGCAGGTCCCCAACCTCACTCCTCTGAAGACTCTTCTGGAGAT
CCTCTGTGATGCACAGATCTCCAGACTCAGTGCCCCCAGACTCAGATTCCCTGGGTGGGGAGGTCTGGGGATCTCTGCTT
GTAATCAGCTCCCTAGAGGTTCCCATGTAGCCAGATAAGTATTGTCAGAACACTGAAGATTTTTGAAAAATGAAAAAGAG
AAGGTTGGAGATGTGTCTTCAGAAGATTACTAAGGGTGCTGGCTAGAGGAGGGACCAGAGGCAGGGAGATGAGGTAGGAA
ACTGCTATTATTTGTCAGGGAAATTGCAATCAAGGCATGAGTTAGAACAGGGAAAACACAGAGGCAAGGGAGAGGTGGAA
GGGGGAGGAAAGAAGTAGTGACAATTCCAGGGTGGATGTCCACCCAAATCTAGAAGTAATTGAGCAAATGTTTTCTGGGC
ATTAGAGAAGGCAACTAGAACAAACAGGAATCCTTGCCTTGGTGAAATGTATTTGAACTGGGTCAGAAATGAGGCCATTG
GGTATCAGGCCTTAACTCCAGCGCACCCTGGAGGTCACTGATGTGGCTCCAGGCTGACCTGCTCCTGTCAAAGAATATTG
AGCAAGATGCCTCTCGTGGAATGTTCTGGGACCTTAAAACAGATACCCAAGTATTCCCCCTGATTTCATGGTTCCCAGAA
GCTCTATGGGGAAGAAATTGTAGGTAATTCACAACTGAGATTTAGACATAAGTTGAATAGTGTAATGGACATTGAGTTAA
CCGAGGTAATGAAGTAGTGAGACACAGGTGCCCCTGAAATAAACTCACATTGAGGGAAGAGGCTGACAATGTGGATCAGT
CTGAAAACAAGGCAAAAATACAATAGGGAGTAAGGGTTGTGTGTCAGTTCAAGACTGTACTTTTACCTGGCCCAGCGCCA
TGTTAGGGTATTTGTGTTCTCCAGGAAGTAGAAAGGAAAGAACTGAGTGATTAGGGACCTAGAAGACTAATTTGAGACAT
TCCTCTTGATGAGCTGTTCTCTAGGGTAGTCCTCTGAAAGAGCTGTTCTCTAGTGGATCTCCCTGAATGAACTGTTCTCT
AGGAGCACTTGACCCTTTTCTGTGTTTGTTTTTTGTTTTGTGTTTGTGTTTGTTTTTGAGACAGGTTCTCACTTTGTCTC
CCAGGCTGGAGTGCTGTGGCACCATCATGGCTCACTGCAGCCTCAACCTCCTGGGCTCAAGTGATCCTCCTGCCTCAGCC
TCCCATGTAGCTAGAACTACAGATACACGTACCACCATGTCTGGCTAATTTATTTTTCTTTTTAGAGATGGGTTCTCACT
ATGTTGCCCAGGCCGGTCTCAAAACCCTGGGCTCAAGTGATCCTCATGCCTCAACCTCCCAAAGTGCTAAGATTATAGGC
ATGACCACCATGCCTGGCCTTTTCTGCTTTCTGAGGAGGAAAAAGGTACTGGTGGCAGAGATCCAAAAGAAAAGTTGCCA
GTGGCAGTGTGGAAATTCACCTGAGAACAACAGGACAAGCTGGGGCACAAATGCAAAGATGCAGAGGGAGGCAACACCTG
GTCATCTGTGAGACCTTCATGGGACCTGAAGACGCAGCACAGAGGAGGAACTTGAAAAAGGACGGGATTTCTACTACTCA
AGCATGTAGGAGCTCAGGATATTCTGTAAATATGAAGATTTTGAGTTTTTGTAGGTGAGGTAAAAAAATACATAGGTTTT
TTACAGAATAAGACATGTAAAGCTCTCTTCATTTTCTTTGTATTTTCATGAAGTTATTAGATTCACAGGCCACCATAATG
CCATTGTCTGTATATCTTAATTTCAAGATATTATTTGAGTAAATTTTGCTTCCTTTGTATCAAGATAGAACTTTGAAAAG
GTAGGTAATTTCACAGTTGATCAAATATTCTTTGCCCAAATTACTTTTGGTTAAAATTTCTCCTAAATGTGCTACAGAGT
GCAAACTCTGTCTCCCTGCCATTCCGCTATATACTTACTAACTATTATTTTATTCAAGATCATGCATGCTCTACTTGAAG
GTCTATTTCTATCTTTTCAATGCTACCCTTACCCACTAGCCTAATCACATTATTCCTATTTTCAACATCTAGGAATCAAT
TACATAGTGAACATGCCTAAGAAATAATAATCTGGGCAGATGCAGTGGCTCAGGCCCGTAATCCCAGCCCTTTGAGAGGC
CGAGCGGGTGGATCACTTGAGGTCAGGCGTTGGTCAAGTGCTCCTAGAGAACCAGGCTGACCAACATGGAGAAACCTTGT
CTCTACTAATAATACAAAAATTAGCCAGGTGAAGTGGCAGGCACCTATAATCCCAGCTATTCGGGAGGCTGAGGAAGGAG
AATTGGTTGAAGCCCGGAGGTGGAGGTTGCAGTGAGCCAATATTGCGCCACTGCATTCCAGACTTGGCAACAGAGTGACA
CTCCATCTCAACAAAAAGAAAGAATGAAAGAAAGAAAGAGCGAGATTATGTCTCAAAAAAAAGGAAGGAAGGAAGGAAGG
AAGGAAGGAAGGAAAGAAGGACAATCTCAAATTCTATTTCATTATTTTTCTTCCACGCTCCTAGTCCAGCCTAGGGTGAA
TGTTTCCCCCTCCAAGAAGGGGCCCTTGCAGCACCACAACCTGCTTGTCTGCCACGTGACGGATTTCTACCCAGGCAGCA
TTCAAGTCCGATGGTTCCTGAATGGACAGGAGGAAACAGCTGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGG
ACCTTCCAGATCCTGGTGATGCTGGAAATGACCCCCCAGCAGGGAGATGTCTACACCTGCCAAGTGGAGCACACCAGCAT
GGATAGTCCTGTCACCGTGGAGTGGAGTGAGTCTCTGATGACCCTCTAGACCCCACCTCTGAAGAGCAGGGGACTCTCTG
GCTCTGGGGTCCACTCATCTTATCTTCTGCATCTATACCCTGGGGCCATGTCCAAACCCCATCTTTCTTCTATACCAGCT
CCTGAGCATAGTTTGAAGCCAGGGAAATGGAGACTTCCTGACCTTGGCTTAGGGGTTCCTGAAGATTCATAGTTCTCCCC
CTTGTCAGAGAATCTAGGGACACTGACTGGTCTCGAAACCCTCACACTTAGGAACTGACCTCACACATAGGAACAGTTCT
CTTCCTTCAGCATTTTAGCCTCTTCTCAGGCATTTTGAGAGGCAACTTCCAGAATCAGCATTTGCCACCTTGTTGAGGTC
ACACCCCTGTTCCAGATATGAGGGTGGCTCTTTCTGAATTTCCTCTTAGCAAGCTTTTTCCGCTGCACTGTCCTCATCCC
GATATGCTGCATCAGGCTCCAGAATCTCAGACAGGACATGAGTAGGGATGCAGCTGGTGGAGGTGACACTAAACCTGGGT
CTGTCCTTCCCAGAGGCACAGTCTGATTCTGCCCGGAGTAAGACATTGACGGGAGCTGGGGGCTTCGTGCTGGGGCTCAT
CATCTGTGGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGGTGAGAAAGCCTGCAGGGTGAGCGGGACTTACCTTC
CCCTGGCATATTCACACTTATTCCACGATGAGGGGTTTGACAGAAAAGAAATGTCAGAAAGCTCTAGAGGCCACTGATAT
CAGATAATCGGGGAACAAACATGACCTATAGCGAGAGAGGGATCCCAGGCTGGGATCTTAATGCAGCCAGATGCATGAGG
TCCCAAGTACTCAGGCTCCTGCGGAGCGTCCATTGAGTGATGGGCAATGGAATTTGGTGGGATGGAAATGTTTCTCTAAT
TATCTGAGGTGGTTTCAATGGCTGATTATATAACCTTTCGTCTTTCATTTCAGTTCAACGAGGATCTGCATAAACAGGTA
ATATTCCTGCTTTGATTTCCTTGTGGGGTGGGTTGCAGGAGGATATGAGTCCTTTCTGTGCATTGTAACACTGAGGCTCC
TCCAGGAAGGGAATCTCAGGCATGAACCCCTCTTTCAATGTCAGCCTTCAGGCAAGTGGGGAAAGAGCATTGCTTGGCTC
CATTGCTGAAGGAAGCAGAGATCAACTCTGTTATTTATCAGCCTGAGACGCATCCTCTCACCATAATTTTTCTCTCCTGG
ACTTACAGGAAGGAGGCTGGCAACCTGGGATAACTTGTCTTTTACCCCCACAGGGTTCCTGAGCTCACTGAAAAGACTAT
TGTGCCTTAGGAAAAGCATTTGCTGTGTTTCGTTAGCATCTGGCTCCAGGACAGACCTTCAACTTCCAAATTGGATACTG
CTGCCAAGAAGTTGCTCTGAAGTCAGTTTCTATCATTCTGCTCTTTGATTCAAAGCACTGTTTCTCTCACTGGGCCTCCA
ACCATGTTCCCTTCTTCTTAGCACCACAAATAATCAAAACCCAACATGACTGTTTGTTTTCCTTTAAAAATATGCACCAA
ATCATCTCTCATCACTTTTCTCTGAGGGTTTTAGTAGACAGTAGGAGTTAATAAAGAAGTTCATTTTGGTTTAAACATAG
GAAAGAAGAGAACCATGAAAATGGGGATATGTTAACTATTGTATAATGGGGCCTGTTACACATGACACTCTTCTGAATTG
ACTGTATTTCAGTGAGCTGCCCCCAAATCAAGTTTAGTGCCCTCATCCATTTATGTCTCAGACCACTATTCTTAACTATT
CAATGGTGAGCAGACTGCAAATCTGCCTGATAGGACCCATATTCCCACAGCACTAATTCAACATATACCTTACTGAGAGC
ATGTTTTATCATTACCATTAAGAAGTTAAATGAACATCAGAATTTAAAATCATAAATATAATCTAATACACTTTAA

IMGT/HLA

Sponsors

Animated Sponsors Logo