Allele Report for DPB1*04:01:08

DPB1*04:01:08 View HGVS Report
Pre-2010 Nomenclature: Local Names: HIS_NEW_DPB1_110513_00080
IMGT/HLA Acc No: HLA10329 OMIM Entry: *142858
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KC959363 , KF882479  
Cells Sequence Derived From: HG00006161 , HG00008230  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGCGCGCTTCGACAGCGACGTGGGGGAGTTCAGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo