Allele Report for DPB1*04:01:03

DPB1*04:01:03 View HGVS Report
Pre-2010 Nomenclature: Local Names: DPB1*04:01new
IMGT/HLA Acc No: HLA07382 OMIM Entry: *142858
Assigned: 2011-11-28 Sequence Last Modified: 2012-01-12
Source Entries: HE611275 , KC875989  
Cells Sequence Derived From: HG00006169 , UA2011-tp-3909  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCTGACAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo