Allele Report for DPB1*04:01:01:02

DPB1*04:01:01:02 View HGVS Report
Pre-2010 Nomenclature: Local Names: DPB1*04:01:01:XX
IMGT/HLA Acc No: HLA06633 OMIM Entry: *142858
Assigned: 2011-02-28 Sequence Last Modified: 2011-04-08
Source Entries: CR762479  
Alignment of CDS Source Entries
DPB1*01:01:01

Locus Reference
  Virtual entry for DPB1*04:01:01:02 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From:  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.6633 (Allele OID)
Publications
Horton R et al. Immunogenetics 60:1-18 2008. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 0 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (258 aa)
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTEL
GRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFL
NGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
Nucleotide Sequence Data (777 bps)
ATGATGGTTCTGCAGGTTTCTGCGGCCCCCCGGACAGTGGCTCTGACGGCGTTACTGATGGTGCTGCTCACATCTGTGGT
CCAGGGCAGGGCCACTCCAGAGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCC
TGGAGAGATACATCTACAACCGGGAGGAGTTCGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTG
GGGCGGCCTGCTGCGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAG
ACACAACTACGAGCTGGGCGGGCCCATGACCCTGCAGCGCCGAGTCCAGCCTAGGGTGAATGTTTCCCCCTCCAAGAAGG
GGCCCTTGCAGCACCACAACCTGCTTGTCTGCCACGTGACGGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTG
AATGGACAGGAGGAAACAGCTGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGGACCTTCCAGATCCTGGTGAT
GCTGGAAATGACCCCCCAGCAGGGAGATGTCTACACCTGCCAAGTGGAGCACACCAGCCTGGATAGTCCTGTCACCGTGG
AGTGGAAGGCACAGTCTGATTCTGCCCGGAGTAAGACATTGACGGGAGCTGGGGGCTTCGTGCTGGGGCTCATCATCTGT
GGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGTTCAACGAGGATCTGCATAA
Genomic Sequence Data (11518 bps)
TAATCCCTGTAGATGGGCCAGCAGAATATTTGAGATCACCTTCAGAGCAAAGAAAACGCATAATCTCCCCAAACATCATG
ACTTATCTGACTGGTTAAAATGAGTATCACTGTCTTTCCTCCGTCATCTTAAGTGCATCACAGGCTTTATATTTTCAGAC
CTTTCATACTAACTTTCTGCCTAGTGAGCAATGACTCATACAAAGCTCAGTGTCCATTGGTTCTTTTCTCAGACTCTGTC
CAATCCCAGGGTCACAGAAGACTACTTGGGTTCATGGTCTCTAATATTTCAAACAGGAGCTCCCTTTAGCGAGTCCTTCT
TTTCCTGACTGCAGCTCTTTTCATTTTGCCATCCTTTTCCAGCTCCATGATGGTTCTGCAGGTTTCTGCGGCCCCCCGGA
CAGTGGCTCTGACGGCGTTACTGATGGTGCTGCTCACATCTGTGGTCCAGGGCAGGGCCACTCCAGGTAAGAGCCGAACT
GCCATTCTTGGAGGGTCTGGCTCAGGGAACAATTCCTAGGGGACGTTATCTTTAAGGGATCAAATTCTGAGACAGGCTGC
GGGGGCTCCTGCCCTAAGGCAGTGTCCTCTCTTCCCAGCTAGAGAAAGAGGTTCATCCCCTATAGGATAGCTTGCTACCC
TACTGGCCTATTCTCTCTCCAAGGACATGGGTACAGTAAACAGAGAGAGGTGCCCAGTGGTCAGTGTCTTTGGGGAAAAT
GGGACCAAGAGGTCCTGGATAACCTTGGACAGACAAGGTTTGCAGAGAGAGAAGTTGGCAAGTGCAGGCTCCTGGGCGTG
TTCATGTCTGCATCCAGCCTGGAGGGGACTCAGGCAGAGAGCCCTAAGCTGGAGTGTCCAGGCTCTGAGGATCACTGAGG
ATTCAGTGCTCACGAAGAATGCCTCTTATTCCCCAGGGTGGAGCAGGAGCCCACATCCCTTGGACAATTAAGGAGAGAAG
GGAGGGAGGGGGATAGGTTTTAGCCCCTGAAGGCATTCTCATTAAAGGTACTTCTCCCAGCCTCCCCAGAACTTGGTTAG
GGTACTAGAGTGGGTTGCGACTTGTAGGAAGAATGAGATGAGGTTGTGTGGGTGCATGACAGGGATTGAGTGTAGGTTAT
CAGACAGCCAAGGAAGCAGTAACCAAGTGAAAAATCTCTTCTTCCTGCTGCCTCCCTGTGGCTGGTGTAATATTATGGCA
TCTATGATCCATTGTTTTTCTCTCAGGATACTCTCAGGATATTTCTTTTTATATATATATATACTTTAAGTTCTAGGGTA
CATGTGCACAACGTGCAGGTTTGTTACATATGTATACATGTGCCATGTTGGTGTGCTGCACCCATTAACTCGTCATTTAC
ATTAGGTATATTTCCTAATGCTATCCCTCCCCCCTCCCCCCACCCCACAACAGGCCCCGGTGTATGATGTTCCCCTTCCT
GTGTCCATGTGTTCTCATTGTTCAGTTCCCACCTATGAGTGAGAACATGTGGTCTTTGGTTTTTTGTCCTTGCAATAGTT
TGCTGTGAATGATGATTTCCAGCTTCCTCCATGTCCCTACAAAGGACATGAACTCATCCTTTTTTATGGCTGCACAGTAT
TCCATGGTGTATATGTGTGCATTTTCTTAATCCAGTCTATCACTGATGGACAGTTGGGTTGGTTCCAAGTCTTTGCTATT
GTGAATAGTGCCGCAATAAACATATGTGTGCATGTGTCTTTATAGCAGCATGATTTATAATCCTTTGGGTATATATCCAG
TAATGGGATGGCTGGGTCAAATGGTATTTCTAGTTCTAGATCTTTGAGGAATTGCCACACTGTCTTGAGATACCATCTCA
CACCAGTTAAAATGGCGATCATTAAAAAGTCAGGAAACAACAGGTGCTGGAGAGGATGTGGAGAAATAGGAACACTTTTA
CTCTGTTGGTGGGACTGTAAACTAGTTCAACCATTGTACTCTCAGGACATTTCTAGTCCAAATTTACACCAACACTCTGA
GAGGAAGGACTGCAAAGTAGGTACCTTAGTTTTCCACTGACTTCCACTTTTCCTGCTTACACCCTTCCTCCTAGACCTCT
CCACACCCCTCCTAGGACACACCTAGAAGGTACTGACATCATGTCACCTCCTCATCTTTCAGGGTAGCAAGGTTGGAATC
TCCTGAATACAGCCCCTCAAGCCCTAAAACCTCTTATCTATTACCTTGGGTTCATTGTCCAGGAAGGGGAGGAGAACTTG
AACTTGTAGTCACAGAAGGGTGCTGAGAACTAACCAGCAGGACGGCTCAGCCCTGGGAACTGCAGAGGGGTGAGGCTGGG
GAGAGAGGAGGCTGGAGCAGCACTGGTGACACTGAACAGTGTCAGGAGGAAGTGACGGATGCAGCGCCCCCATCCCATAG
GCAGAGCTGTCATGTGGGATGAGGGACAGTGTTGGGAGCCACCAAGGAAACCCAGAGGTGGGGGAGCAGAGAGCAGAAGG
GGGCATGTGATGCTGGGCAGTGAAAGGGAGGACGGGCAAAGGCTGGGTTGAGGTTTGTAGGGGGAATGAGATGAGGCAGT
GGAGCCATGTGACAGGGACTGAGGGTAGATTACTGGAGCTCCCTGCGTAGAATGAATGTTCAATCAAAACCTGCTGGAGG
GAGAGCTGGAGCCATAGGGGAGTGGGTAAAGTGGGCAGGGCTGATTCCACAATTCCCTGCATGCTCCCCCAACTCCACAC
ACATCCCCAACCTCAAACAGGGCACAAGACCAAAGGGCTGAGGAGCCAGGCTATAGCTTAAAGAGGCTGGGGGAGAAAAG
CTTGGCTGAGACAACCCATAGGGAGCTAGAGGTTTTTAATATATCCTATTCTGAATAAGAGACGAATTCATTCAGATCAG
TGGTTTCAAACCGTGCTCTGGGCAACTCAATTGCTAAGGGTTCCACAAACAGGATAAAGTTTCTTATATACAAAAAAAAA
TGAAGGTTTCAAATTACACCATAAAACCCCTCATTGCTTATGTCTACTTGGCAGGTAAAATTCCATTTCAAAAGTTAAAT
GTACTTAAAAAATTACCTAAGACTGGGTAAATTAAAAAAATTAAATGTTGCAAAGAAAAAATTCAAAATTCTTATTCTTG
AATGAAAAACGTTCTCTTACTGGTGATTGAGGAGGAGAAACAAAGACTAACAAATGAAAATGGGAGAATCCACACTCAGA
GTGGGGCAATTGAACAGGCAGGGGCGGATGGATGGCAGAGGAGGAGGAATCTGGACTCAAGGAGCTGGGGGGCTCTGGGC
CTGGAATTTTAGGGTCTGGGGCCCAAGGCACCAGGAGAAGAGGCAGGTCAGGATATCTGAGTCAAGACCTGGGATCTTGC
CTTAGCAATGACACTGGAGACTAAAGGTGGACTCCATGGTGCCCTTGAGCCCAGCCCTACCCCATCTCCACTATCCTCTG
CCACCAGCTGTGCAACTTCTGCTAGGGGTGAGGTTAATAAACTGGAGAAGTTAATTTGTGGAGCATGAAACAGATGAGCA
GAACAATCACAGCACCTTAATTTCCCCAGTGTGCCCAAGAACAGAGCAGGCCTGAAGATACTCAAACAGAAACAAACATG
TGCCGTGTCACTGATAATTCTGTGTAGACACACACCTGCCAGACACTGCTCATGGCACTCCCTAGGAAGAACAGCATGTG
GGAAAGGCTGCCAAAATTGTTCATGTAAAAATTACATCAATGCTGTCTTCCTCGGTGCTGCCTATGCAGCTGGCAGCCAT
CTCTTCCTCCACATCATGGCCTCCCTCAGACTCCTCATGAAGGATAAGATCCTCAAAAAGAGGACCAACAAGTTCATGAG
GCACCAATCAGACTGAAATGTCAAAATTAAGCATAACTGGCGGAAACCCAGAGGTCTTAACAGTAGGGTTCGTAGAAGGT
CCAAGGGCCAGATCTTGATGCCCAACATTGCTTATGGGAGCAACAACAACAACAAAAAAAACATGCTGCCCAGTGGCTTC
CAGAAGTTTCTGGTCCACAGCCTCAAGGAGCTGAAAGTGCTGCTGATGTGCAACAAATCTTACTGTGCTGAGATCGCTCA
CAAAATTTCCTCCAGAACTGCAAAGTCATCATGGAAAGAGTCACCCAGCCGGCCATCAGAGTCACCAACCCCAGTACCAG
GGTGCACAGCTAAGAAAATGAGTAGAAAGTTCATGTCCACGTTTTGTGTGTAAATAAAACCATAAAAACTGCCAAAAAAA
ATTACATCAATGCCTCTAAACCCAAAGGACTCTACCCCCACAGGTCCCTGGTTGTTGTGGTGATTTTCATTGTGTAAAAT
ACTTTCCACATCTTTTGACACCAAGTCTTTCTGCAGCCATGTTTGAAAATTAACTTTCAGGCTACAGAGTCTTTCTTATA
CCAAAGTTGAAGAAAGTTTTAAGAAATATATTTCTACATCTCCTACATGCAAAACAACAGGAGCAAGTTGAGGAATTCTC
AAGAAACTGGTCGAGAAGAGAGAGCGCTTAGCTATGGAAAAGAGAAAGAAGGAAGGGAGGGCTTCCTGGAGGAGGTGGCA
TTTGAACCAGGACTGACATCAGGATGGAAATGTCAGTCAGGGAGTTAAGTAGGGGGAGCAGCTCCGCCCTCCACGTCCCC
AGCTCCTCCCGCCCCTGTTTTTTCTCCCAGTGACCCCACGTGAAACGTCTCCGCCTCCTCCAGCCACCAGCAGAAGGGAC
TGCCTTCCCCTCAGTGCTCGCCCCTCCCTAGTGATCACTCAGTGCCCCTGAGCTCATTCTTTTCAGTAAATTCTCTCTCT
GCGTGGTGAGAAAACAGGCCTGGAGAGGCTCTGCGACCCGCTTAGGACCACAGAACTCGGTACTAGGAAAACTCCTATTT
TAAAATCCAGCCCTGGGTGGGAAGATTTGGGAAGAATCGTTAATATTGAGAGAGAGAGGGAGAAAGAGGATTAGATGAGA
GTGGCGCCTCCGCTCATGTCCGCCCCCTCCCCGCAGAGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAAT
GGGACACAGCGCTTCCTGGAGAGATACATCTACAACCGGGAGGAGTTCGCGCGCTTCGACAGCGACGTGGGGGAGTTCCG
GGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGGAGAAGCGGGCAGTGC
CGGACAGGATGTGCAGACACAACTACGAGCTGGGCGGGCCCATGACCCTGCAGCGCCGAGGTGAGTGAGGGCTTTGGGCC
GGCGGTCCCAGGGCAGCCCCGCGGGCCCGTGCCCAGGGCGCAGGAGCAGCCGGGTTGGCCTAAGGGACCTTAGTGCCGGG
CGGAAAGGGGACTTTGGGTTGGGGATTCATGGGGGGAGCCCATCTGGAGCTTGTCAGGGGAGCGAGCGCGGGGACCTGGA
CTGGGCTGAGCATGGAGTGAGGAGGACGAGAGCAGAGAGACCCCCGGGACTTCATCAGGCCTGGCAGCTGACTGCATGTG
GGGTGAAAAAAGGAAGCCACAGGACAGCGCACAAGGGTATGGTGTGGAGATGGAGGTGGAGATGGCACAGCAGGCCACAC
AGAGAAGAAACCTACAGGGAGGTAGCTGGGTTTGAGGTGCTTGAGGGGCAGATGGGTGGTCTGATGGGCAGGTAGACAGA
AGGGTCTGCAGCCGGGGAGGAGACTGAGATACATGAGACCATCCAGGGAGAGGGGACCCAGGGGGAAGAGCAAAGGACCG
GATCCTGGGAACTGGACAGTTGTGATTTGGCCAAGACAGAAAAGCCTGTGAAAGAGACCAAAAAAACCCAAGTGCAGTGT
GAGGAGAGGCCCGCAGAGAAGAGTCTTGGAAGCTGAGGGGAGGTGACCTCAGCAGCACAGTGGACAGCGGTGCCAGTGAC
TTGGGAAGGTCAGAAAACAGAAGATGGAAAGTGGGTTTGGAAACCAGGGAGACCTGGGGAGAGCAGGTTGGCCGCAGCGG
CAGGAGCTGGAATGGGAGGGGGTGCATGAGGCTGAGTGTGGCGCATCCTCCTCGGGGCTGAGATGGATTTTACTTGTCTT
GGGTTCCCCACGGCTGTCACAGGGCAGTGTCTCAGTTCATTCGTCTTTTTCCTTCAGGAAGTCTGGGTGTAAAGGGATGG
AGAGAGGTGAGGTGTGTGCAGTAAGAGGATTTCTCAAGGATGGGACAGGAAGGCCTTGGAGCTTTGGCTTCCTCCTGTGA
ACTTGTGGGGTGGGGAGCCTGGTGCACCAACCTGAGGGACTTGAGGGAGTAGTATCAGGATGTGGGATTGAGCCCTGGAC
CTTTTTTCTAGAAAGAGGAAAAAAATGAAGGGAGGAGGAGGAGGAAGCTGGGGAGATCACACCTTTGATTTTCTTGTTCC
TGGAAAGTGAAAGGAAGTTCACCTGCTATGAGTGAGAAGGTGGACACACTGGGTGGGGATGAGGTGAGTGACATGAGCTT
AGGAAAGTTGCTGAGGTAATTGGTTGAGAGAGGTGTTCAAATAAAAATAACGCAATTGGCAAAAACTGTTACTAAGACTT
TGTAGAGGCACCAATCAGTGACATGGCAGCATTTTCTTTCACAGTAATCAACTGCCAGATTGCAGACAGCCCTGATGCCA
GCCTAAGGAGTGTGGGTTTCTCCTCCAGGCCCGCAGGTCCCCAACCTCACTCCTCTGAAGACTCTTCTGGAGATCCTCTG
TGATGCACAGATCTCCAGACTCAGTGCCCCCAGACTCAGATTCCCTGGGTGGGGAGGTCTGGGGATCTCTGCTTGTAATC
AGCTCCCTAGAGGTTCCCATGTAGCCAGATAAGTATTGTCAGAACACTGAAGATTTTTGAAAAATGAAAAAGAGAAGGTT
GGAGATGTGTCTTCAGAAGACTACTAAGGGTGCTGGCTAGAGGAGGGACCAGAGGCAGGGAGATGAGGTAGGAAACTGCT
ATTATTTGTCAGGGAAATTGCAATCAAGGCATGAGTTAGAACAGGGAAAACACAGAGGCAAGGGAGAGGTGGAAGGGGGA
GGAAAGAAGTAGTGACAATTCCAGGGTGGATGTCCACCCAAATCTAGAAGTAATTGAGCAAATGTTTTCTGGGCATTAGA
GAAGGCAACTAGAACAAACAGGAATCCTTGCCTTGGTGAAATGTATTTGAACTGGGTCAGAAATGAGGCCATTGGGTATC
AGGCCTTAACTCCAGCGCACCCTGGAGGTCACTGATGTGGCTCCAGGCTGACCTGCTCCTGTCAAAGAATATTGAGCAAG
ATGCCTCTCGTGGAATGTTCTGGGACCTTAAAACAGATACCCAAGTATTCCCCCTGATTTCATGGTTCCCAGAAGCTCTA
TGGGGAAGAAATTGTAGGTAATTCACAACTGAGATTTAGACATAAGTTGAATAGTGTAATGGACATTGAGTTAACCGAGG
TAATGAAGTAGTGAGACACAGGTGCCCCTGAAATAAACTCACATTGAGGGAAGAGGCTGACAATGTGGATCAGTCTGAAA
ACAAGGCAAAAATACAATAGGGAGTAAGGGTTGTGTGTCAGTTCAAGACTGTACTTTTACCTGGCCCAGCGCCATGTTAG
GGTATTTGTGTTCTCCAGGAAGTAGAAAGGAAAGAACTGAGTGATTAGGGACCTAGAAGACTAATTTGAGACATTCCTCT
TGATGAGCTGTTCTCTAGGGTAGTCCTCTGAAAGAGCTGTTCTCTAGTGGATCTCCCTGAATGAACTGTTCTCTAGGAGC
ACTTGACCCTTTTCTGTGTTTGTTTTTTGTTTTGTGTTTGTGTTTGTTTTTGAGACAGGTTCTCACTTTGTCTCCCAGGC
TGGAGTGCTGTGGCACCATCATGGCTCACTGCAGCCTCAACCTCCTGGGCTCAAGTGATCCTCCTGCCTCAGCCTCCCAT
GTAGCTAGAACTACAGATACACGTACCACCATGTCTGGCTAATTTATTTTTCTTTTTAGAGATGGGTTCTCACTATGTTG
CCCAGGCCGGTCTCAAAACCCTGGGCTCAAGTGATCCTCATGCCTCAACCTCCCAAAGTGCTAAGATTATAGGCATGACC
ACCATGCCTGGCCTTTTCTGCTTTCTGAGGAGGAAAAAGGTACTGGTGGCAGAGATCCAAAAGAAAAGTTGCCAGTGGCA
GTGTGGAAATTCACCTGAGAACAACAGGACAAGCTGGGGCACAAATGCAAAGATGCAGAGGGAGGCAACACCTGGTCATC
TGTGAGACCTTCATGGGACCTGAAGACGCAGCACAGAGGAGGAACTTGAAAAAGGACGGGATTTCTACTACTCAAGCATG
TAGGAGCTCAGGATATTCTGTAAATATGAAGATTTTGAGTTTTTGTAGGTGAGGTAAAAAAATACATAGGTTTTTTACAG
AATAAGACATGTAAAGCTCTCTTCATTTTCTTTGTATTTTCATGAAGTTATTAGATTCACAGGCCACCATAATGCCATTG
TCTGTATATCTTAATTTCAAGATATTATTTGAGTAAATTTTGCTTCCTTTGTATCAAGATAGAACTTTGAAAAGGTAGGT
AATTTCACAGTTGATCAAATATTCTTTGCCCAAATTACTTTTGGTTAAAATTTCTCCTAAATGTGCTACAGAGTGCAAAC
TCTGTCTCCCTGCCATTCCGCTATATACTTACTAACTATTATTTTATTCAAGATCATGCATGCTCTACTTGAAGGTCTAT
TTCTATCTTTTCAATGCTACCCTTACCCACTAGCCTAATCACATTATTCCTATTTTCAACATCTAGGAATCAATTACATA
GTGAACATGCCTAAGAAATAATAATCTGGGCAGATGCAGTGGCTCAGGCCCGTAATCCCAGCCCTTTGAGAGGCCGAGCG
GGTGGATCACTTGAGGTCAGGCGTTGGTCAAGTGCTCCTAGAGAACCAGGCTGACCAACATGGAGAAACCTTGTCTCTAC
TAATAATACAAAAATTAGCCAGGTGAAGTGGCAGGCACCTATAATCCCAGCTATTCGGGAGGCTGAGGAAGGAGAATTGG
TTGAAGCCCGGAGGTGGAGGTTGCAGTGAGCCAATATTGCGCCACTGCATTCCAGACTTGGCAACAGAGTGACACTCCAT
CTCAACAAAAAGAAAGAATGAAAGAAAGAAAGAGCGAGATTATGTCTCAAAAAAAAGGAAGGAAGGAAGGAAGGAAGGAA
GGAAGGAAGGAAGGAAAGAAGGACAATCTCAAATTCTATTTCATTATTTTTCTTCCACGCTCCTAGTCCAGCCTAGGGTG
AATGTTTCCCCCTCCAAGAAGGGGCCCTTGCAGCACCACAACCTGCTTGTCTGCCACGTGACGGATTTCTACCCAGGCAG
CATTCAAGTCCGATGGTTCCTGAATGGACAGGAGGAAACAGCTGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACT
GGACCTTCCAGATCCTGGTGATGCTGGAAATGACCCCCCAGCAGGGAGATGTCTACACCTGCCAAGTGGAGCACACCAGC
CTGGATAGTCCTGTCACCGTGGAGTGGAGTGAGTCTCTGATGACCCTCTAGACCCCACCTCTGAAGAGCAGGGGACTCTC
TGGCTCTGGGGTCCACTCATCTTATCTTCTGCATCTATACCCTGGGGCCATGTCCAAACCCCATCTTTCTTCTATACCAG
CTCCTGAGCATAGTTTGAAGCCAGGGAAATGGAGACTTCCTGACCTTGGCTTAGGGGTTCCTGAAGATTCATAGTTCTCC
CCCTTGTCAGAGAATCTAGGGACACTGACTGGTCTCGAAACCCTCACACTTAGGAACTGACCTCACACATAGGAACAGTT
CTCTTCCTTCAGCATTTTAGCCTCTTCTCAGGCATTTTGAGAGGCAACTTCCAGAATCAGCATTTGCCACCTTGTTGAGG
TCACACCCCTGTTCCAGATATGAGGGTGGCTCTTTCTGAATTTCCTCTTAGCAAGCTTTTTCCGCTGCACTGTCCTCATC
CCGATATGCTGCATCAGGCTCCAGAATCTCAGACAGGACATGAGTAGGGATGCAGCTGGTGGAGGTGACACTAAACCTGG
GTCTGTCCTTCCCAGAGGCACAGTCTGATTCTGCCCGGAGTAAGACATTGACGGGAGCTGGGGGCTTCGTGCTGGGGCTC
ATCATCTGTGGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGGTGAGAAAGCCTGCAGGGTGAGCGGGACTTACCT
TCCCCTGGCATATTCACACTTATTCCACGATGAGGGGTTTGACAGAAAAGAAATGTCAGAAAGCTCTAGAGGCCACTGAT
ATCAGATAATCGGGGAACAAACATGACCTATAGCGAGAGAGGGATCCCAGGCTGGGATCTTAATGCAGCCAGATGCATGA
GGTCCCAAGTACTCAGGCTCCTGCGGAGCGTCCATTGAGTGATGGGCAATGGAATTTGGTGGGATGGAAATGTTTCTCTA
ATTATCTGAGGTGGTTTCAATGGCTGATTATATAACCTTTCGTCTTTCATTTCAGTTCAACGAGGATCTGCATAAACAGG
TAATATTCCTGCTTTGATTTCCTTGTGGGGTGGGTTGCAGGAGGATATGAGTCCTTTCTGTGCATTGTAACACTGAGGCT
CCTCCAGGAAGGGAATCTCAGGCATGAACCCCTCTTTCAATGTCAGCCTTCAGGCAAGTGGGGAAAGAGCATTGCTTGGC
TCCATTGCTGAAGGAAGCAGAGATCAACTCTGTTATTTATCAGCCTGAGACGCATCCTCTCACCATAATTTTTCTCTCCT
GGACTTACAGGAAGGAGGCTGGCAACCTGGGATAACTTGTCTTTTACCCCCACAGGGTTCCTGAGCTCACTGAAAAGACT
ATTGTGCCTTAGGAAAAGCATTTGCTGTGTTTCGTTAGCATCTGGCTCCAGGACAGACCTTCAACTTCCAAATTGGATAC
TGCTGCCAAGAAGTTGCTCTGAAGTCAGTTTCTATCATTCTGCTCTTTGATTCAAAGCACTGTTTCTCTCACTGGGCCTC
CAACCATGTTCCCTTCTTCTTAGCACCACAAATAATCAAAACCCAACATGACTGTTTGTTTTCCTTTAAAAATATGCACC
AAATCATCTCTCATCACTTTTCTCTGAGGGTTTTAGTAGACAGTAGGAGTTAATAAAGAAGTTCATTTTGGTTTAAACAT
AGGAAAGAAGAGAACCATGAAAATGGGGATATGTTAACTATTGTATAATGGGGCCTGTTACACATGACACTCTTCTGAAT
TGACTGTATTTCAGTGAGCTGCCCCCAAATCAAGTTTAGTGCCCTCATCCATTTATGTCTCAGACCACTATTCTTAACTA
TTCAATGGTGAGCAGACTGCAAATCTGCCTGATAGGACCCATATTCCCACAGCACTAATTCAACATATACCTTACTGAGA
GCATGTTTTATCATTACCATTAAGAAGTTAAATGAACATCAGAATTTAAAATCATAAATATAATCTAATACACTTTAA

IPD-IMGT/HLA

Sponsors