Allele Report for DPB1*103:01

DPB1*103:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*0403 Local Names: HWS10002709
IMGT/HLA Acc No: HLA02042 OMIM Entry: *142858
Assigned: 2004-12-13 Sequence Last Modified: 2005-01-12
Source Entries: AY823995  
Cells Sequence Derived From: CBD1  
Known Ethnic Origin Of Source: Black
CWD v2.0 Status: Not defined
Publications
Weston A et al. DNA Seq 16:235-6 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTELGRPAAEYWNSQKDILEEERAVPDRMCRHNYELDE
AVTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGAGTA
CTGGAACAGCCAGAAGGACATCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo