Allele Report for DPB1*03:01:01

DPB1*03:01:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*030101 Local Names: DPB1*03011, DPB3
IMGT/HLA Acc No: HLA00520 OMIM Entry: *142858
Assigned: 1989-08-01 Sequence Last Modified: 1999-08-06
Source Entries: AL662824 , M23682 , M62334 , X02964 , X03023 , X03024 , X03027 , X78044  
Cells Sequence Derived From: ETH9-0226 , PRIESS , SLE005  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Kappes DJ et al. EMBO J 3:2985-93 1984. (View abstract)
Bugawan TL et al. J Immunol 141:4024-30 1988. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 4
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (258 aa)
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYVYQLRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTEL
GRPDEDYWNSQKDLLEEKRAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFL
NGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYICQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
Nucleotide Sequence Data (777 bps)
ATGATGGTTCTGCAGGTTTCTGCGGCCCCCCGGACAGTGGCTCTGACGGCGTTACTGATGGTGCTGCTCACATCTGTGGT
CCAGGGCAGGGCCACTCCAGAGAATTACGTGTACCAGTTACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCC
TGGAGAGATACATCTACAACCGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTG
GGGCGGCCTGATGAGGACTACTGGAACAGCCAGAAGGACCTCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGGTATGCAG
ACACAACTACGAGCTGGACGAGGCCGTGACCCTGCAGCGCCGAGTCCAGCCTAAGGTGAACGTTTCCCCCTCCAAGAAGG
GGCCCCTGCAGCACCACAACCTGCTTGTCTGCCACGTGACAGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTG
AATGGACAGGAGGAAACAGCTGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGGACCTTCCAGATCCTGGTGAT
GCTGGAAATGACCCCCCAGCAGGGAGACGTCTACATCTGCCAAGTGGAGCACACCAGCCTGGACAGTCCTGTCACCGTGG
AGTGGAAGGCACAGTCTGATTCTGCCCGGAGTAAGACATTGACGGGAGCTGGGGGCTTCGTGCTGGGGCTCATCATCTGT
GGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGTTCAACGAGGATCTGCATAA
Genomic Sequence Data (11461 bps)
TAATCCCTGTAGATGGGCCAGCAGAATATTTGAGATCACCTTCAGAGCAAAGAAAACGCATAATCTCCCCAAACATCATG
ACTTATCTGACTGGTTAAAATGAGTATCACTGTCTTTCCTCCGTCATCTTAAGTGCATCACAGGCTTTATATTTTCAGAC
CTTTCATACTAACTTTCTGCCTAGTGAGCAATGACTCATACAAAGCTCAGTGTCCATTGGTTCTTTTCTCAGACTCTGTC
CAATCCCAGGGTCACAGAAGACTACTTGGGTTCATGGTCTCTAATATTTCAAACAGGAGCTCCCTTTAGCGAGTCCTTCT
TTTCCTGACTGCAGCTCTTTTCATTTTGCCATCCTTTTCCAGCTCCATGATGGTTCTGCAGGTTTCTGCGGCCCCCCGGA
CAGTGGCTCTGACGGCGTTACTGATGGTGCTGCTCACATCTGTGGTCCAGGGCAGGGCCACTCCAGGTAAGAGCCGAACT
GCCATTCTTGGAGGGTCTGGCTCAGGGAACAATTCCTAGGGGACGTTATCTTTAAGGGATCAAATTCTGAGACAGGCTGC
GGGGGCTCCTGCCCTAAGGCAGTGTCCTCTCTTCCCAGCTAGAGAAAGAGGTTCATCCCCTATAGGATAGCTTGCTACCC
TACTGGCCTATTCTCTCTCCAAGGACATGGGTACAGTAAACAGAGAGAGGTGCCCAGTGGTCAGTGTCTTTGGGGAAAAT
GGGACCAAGAGGTCCTGGATAACCTTGGACAGACAAGGTTTGCAGAGAGAGAAGTTGGCAAGTGCAGGCTCCTGGGCGTG
TTCATGTCTGCATCCAGCCTGGAGGGGACTCAGGCAGAGAGCCCTAAGCTGGAGTGTCCAGGCTCTGAGGATCACTGAGG
ATTCAGTGCTCACGAAGAATGCCTCTTATTCCCCAGGGTGGAGCAGGAGCCCACATCCCTTGGACAATTAAGGAGAGAAG
GGAGGGAGGGGGATAGGTTTTAGCCCCTGAAGGCATTCTCATTAAAGGTACTTCTCCCAGCCTCCCCAGAACTTGGTTAG
GGTACTAGAGTGGGTTGCGACTTGTAGGAAGAATGAGATGAGGTTGTGTGGGTGCATGACAGGGATTGAGTGTAGGTTAT
CAGACAGCCAAGGAAGCAGTAACCAAGTGAAAAATCTCTTCTTCCTGCTGCCTCCCTGTGGCTGGTGTAATATTATGGCA
TCTATGATCCATTGTTTTTCTCTCAGGATACTCTCAGGATATTTCTTTTTATATATATATATACTTTAAGTTCTAGGGTA
CATGTGCACAACGTGCAGGTTTGTTACATATGTATACATGTGCCATGTTGGTGTGCTGCACCCATTAACTCGTCATTTAC
ATTAGGTATATTTCCTAATGCTATCCCTCCCCCCTCCCCCCACCCCACAACAGGCCCCGGTGTATGATGTTCCCCTTCCT
GTGTCCATGTGTTCTCATTGTTCAGTTCCCACCTATGAGTGAGAACATGTGGTCTTTGGTTTTTTGTCCTTGCAATAGTT
TGCTGTGAATGATGATTTCCAGCTTCCTCCATGTCCCTACAAAGGACATGAACTCATCCTTTTTTATGGCTGCACAGTAT
TCCATGGTGTATATGTGTGCATTTTCTTAATCCAGTCTATCACTGATGGACAGTTGGGTTGGTTCCAAGTCTTTGCTATT
GTGAATAGTGCCGCAATAAACATATGTGTGCATGTGTCTTTATAGCAGCATGATTTATAATCCTTTGGGTATATATCCAG
TAATGGGATGGCTGGGTCAAATGGTATTTCTAGTTCTAGATCTTTGAGGAATTGCCACACTGTCTTGAGATACCATCTCA
CACCAGTTAAAATGGCGATCATTAAAAAGTCAGGAAACAACAGGTGCTGGAGAGGATGTGGAGAAATAGGAACACTTTTA
CTCTGTTGGTGGGACTGTAAACTAGTTCAACCATTGTACTCTCAGGACATTTCTAGTCCAAATTTACACCAACACTCTGA
GAGGAAGGACTGCAAAGTAGGTACCTTAGTTTTCCACTGACTTCCACTTTTCCTGCTTACACCCTTCCTCCTAGACCTCT
CCACACCCCTCCTAGGACACACCTAGAAGGTACTGACATCATGTCACCTCCTCATCTTTCAGGGTAGCAAGGTTGGAATC
TCCTGAATACAGCCCCTCAAGCCCTAAAACCTCTTATCTATTACCTTGGGTTCATTGTCCAGGAAGGGGAGGAGAACTTG
AACTTGTAGTCACAGAAGGGTGCTGAGAACTAACCAGCAGGACGGCTCAGCCCTGGGAACTGCAGAGGGGTGAGGCTGGG
GAGAGAGGAGGCTGGAGCAGCACTGGTGACACTGAACAGTGTCAGGAGGAAGTGACGGATGCAGCGCCCCCATCCCATAG
GCAGAGCTGTCATGTGGGATGAGGGACAGTGTTGGGAGCCACCAAGGAAACCCAGAGGTGGGGGAGCAGAGAGCAGAAGG
GGGCATGTGATGCTGGGCAGTGAAAGGGAGGACGGGCAAAGGCTGGGTTGAGGTTTGTAGGGGGAATGAGATGAGGCAGT
GGAGCCATGTGACAGGGACTGAGGGTAGATTACTGGAGCTCCCTGCGTAGAATGAATGTTCAATCAAAACCTGCTGGAGG
GAGAGCTGGAGCCATAGGGGAGTGGGTAAAGTGGGCAGGGCTGATTCCACAATTCCCTGCATGCTCCCCCAACTCCACAC
ACATCCCCAACCTCAAACAGGGCACAAGACCAAAGGGCTGAGGAGCCAGGCTATAGCTTAAAGAGGCTGGGGGAGAAAAG
CTTGGCTGAGACAACCCATAGGGAGCTAGAGGTTTTTAATATATCCTATTCTGAATAAGAGACGAATTCATTCAGATCAG
TGGTTTCAAACCGTGCTCTGGGCAACTCAATTGCTAAGGGTTCCACAAACAGGATAAAGTTTCTTATATACAAAAAAAAT
GAAGGTTTCAAATTACACCATAAAACCCCTCATTGCTTATGTCTACTTGGCAGGTAAAATTCCATTTCAAAAGTTAAATG
TACTTAAAAAATTACCTAAGACTGGGTAAATTAAAAAAATTAAATGTTGCAAAGAAAAAATTCAAAATTCTTATTCTTGA
ATGAAAAACGTTCTCTTACTGGTGATTGAGGAGGAGAAACAAAGACTAACAAATGAAAATGGGAGAATCCACACTCAGAG
TGGGGCAATTGAACAGGCAGGGGCGGATGGATGGCAGAGGAGGAGGAATCTGGACTCAAGGAGCTGGGGGGCCCTGGGCC
TGGAATTTCAGGGTCTGGCGCCCAAGGCACCAGGAGAAGAGGCAGGTCAGGATATCTGAGTCAAGACCTGGGATCTTGCC
TTAGCAATGACACTGGAGACTAAAGGTGGACTCCATGGTGCCCTTGAGCCCAGCCCTACCCCATCTCCACTATCCTCTGC
CACCAGCTGTGCAACTTCTGCAAGGGGTGAGGTTAATAAACTGGAGAAGTTAATTTGTGGAGCATGAAACAGATGAGCAG
AACAATCACAGCACCTTAATTTCCCCAGTGTGCCCAAGAACAGAGCAGGCCTGAAGACACTCAAACAGAAACAAACATGT
GCCGTGTCACTGATAATTCTGTGTAGACACACACCTGCCAGACACTGCTCATGGCACTCCCTAGGAAGAACAGCATGTGG
GAAAGGCTGCCAAAATTGTTCATGTAAAAATTACATCAATGCTGTCTTCCTCGGTGCTGCCTATGCAGCTGGCAGCCATC
TCTTCCTCCACATCATGGCCTCCCTCAGACTCCTCATGAAGGATAAGATCCTCAAAAAGAGGACCAACAAGTTCATGAGG
CACCAATCAGACTGAAATGTCAAAATTAAGCATAACTGGCGGAAACCCAGAGGTCTTAACAGTAGGGTTCGTAGAAGGTC
CAAGGGCCAGATCTTGATGCCCAACATTGCTTATGGGAGCAACAACAACAACAAAAAACACATGCTGCCCAGTGGCTTCC
AGAAGTTTCTGGCCCACAGCCTCAAGGAGCTGAAAGTGCTGCTGATGTGCAACAAATCTTACTGTGCTGAGATCGCTCAC
AAAATTTCCTCCAGAACTGCAAAGTCATCATGGAAAGAGTCACCCAGCCGGCCATCAGAGTCACCAACCCCAGTACCACG
GTGCACAGCTAAGAAAATGAGTAGAAAGTTCATGTCCACGTTTTGTGTGTAAATAAAACCATAAAAACTGCCAAAAAAAA
TTACATCAATGCCTCTAAACCCAAAGGACTCTACCCCCACAGGTCCCTGGTTGTTGTGGTGATTTTCATTGTGTAAAATA
CTTTCCACATCTTTTGACACCAAGTCTTTCTGCAGCCATGTTTGAAAATTAACTTTCAGGCTACAGAGTCTTTCTTATAC
CAAAGTTGAAGAAAGTTTTAAGAAATATATTTCTACATCTCCTACATGCAAAACAACAGGAGCAAGTTGAGGAATTCTCA
AGAAACTGGTCGAGAAGAGAGAGCGCTTAGCTATGGAAAAGAGAAAGAAGGAAGGGAGGGCTTCCTGGAGGAGGTGGCAT
TTGAACCAGGACTGACATCAGGATGGAAATGTCAGTCAGGGAGTTAAGTAGGGGGAGCAGCTCCGCCCTCCACGTCCCCA
GCTCCTCCTGCCCCTGTTTTTTCTCCCAGTGACCCCACGTGAAACGTCTCCGCCTCCTCCAGCCACCAGCAGAAGGGACT
GCCTTCCCCTCAGTGCTCGCCCCTCCCTAGTGATCACTCAGTGCCCCTGAGCTCATTCTTTTCAGTAAATTCTCTCTCTG
CGTGGTGAGAAAACAGGCCTGGAGAGGCTCTGCGACCCGCTTAGGACCACAGAACTCGGTACTAGGAAAACTCCTATTTT
AAAATCCAGCCCTGGGTGGGAAGATTTGGGAAGAATCGTTAATATTAAGAGAGAGAGGGAGAAAGAGGATTAGATGAGAG
TGGCGCCTCCGCTCATGTCCGCCCCCTCCCCGCAGAGAATTACGTGTACCAGTTACGGCAGGAATGCTACGCGTTTAATG
GGACACAGCGCTTCCTGGAGAGATACATCTACAACCGGGAGGAGTTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGG
GCGGTGACGGAGCTGGGGCGGCCTGATGAGGACTACTGGAACAGCCAGAAGGACCTCCTGGAGGAGAAGCGGGCAGTGCC
GGACAGGGTATGCAGACACAACTACGAGCTGGACGAGGCCGTGACCCTGCAGCGCCGAGGTGAGTGAGGGCTTTGGGCCG
GCGGTCCCAGGGCAGCCCCGCGGGCCCGTGCCCAGGGCGCAGGAGCAGCCGGGTTGGCCTAAGGGACCTTAGTGCCGGGC
GGAAAGGGGACTTTGGGTTGGGGATTCATGGGGGGAGCCCATCTGGAGCTTGTCAGGGGAGCGAGCGCGGGGACCTGGAC
TGGGCTGAGCATGGAGTGAGGAGGACGAGAGCAGAGAGACCCCCGGGACTTCATCAGGCCTGGCAGCTGACTGCATGTGG
GGTGAAAAAAGGAAGCCACAGGACAGCGCACAAGGGTATGGTGTGGAGATGGAGGTGGAGATGGCACAGCAGGCCACACA
GAGAAGAAACCTACAGGGAGGTAGCTGGGTTTGAGGTGCTTGAGGGGCAGATGGGTGGTCTGATGGGCAGGTAGACAGAA
GGGTCTGCAGCCGGGGAGGAGACTGAGATACATGAGACCATCCAGGGAGAGGGGACCCAGGGGGAAGAGCAAAGGACTGG
ATCCTGGGAACTGGACAGTTGTGATTTGGCCAAGACAGAAAAGCCTGTGAAAGAGACCAAAAAAACCCAAGTGCAGTGTG
AGGAGAGGCCCGCAGAGAAGAGTCTTGGAAGCTGAGGGGAGGTGACCTCAGCAGCACAGTGGACAGCGGTGCCAGTGACT
TGGGAAGGTCAGAAAACAGAAGATGGAAAGTGGGTTTGGAAACCAGGGAGACCTGGGGAGAGCAGGTTGGCCGCAGCGGC
AGGAGCTGGAATGGGAGGGGGTGCATGAGGCTGAGTGTGGCGCATCCTCCTCGGGGCTGAGATGGATTTTACTTGTCTTG
GGTTCCCCACGGCTGTCACAGGGCAGTGTCTCAGTTCATTCGTCTTTTTCCTTCAGGAAGTCTGGGTGTAAAGGGATGGA
GAGAGGTGAGGTGTGTGCAGTAAGAGGATTTCTCAAGGATGGGACAGGAAGGCCTTGGAGCTTTGGCTTCCTCCTGTGAA
CTTGTGGGGTGGGGAGCCTGGTGCACCAACCTGAGGGACTTGAGGGAGTAGTATCAGGATGTGGGATTGAGCCCTGGACC
TTTTTTCTAGAAAGAGGAAAAAAATGAAGGGAGGAGGAGGAGGAAGCTGGGGAGATCACACCTTTGATTTTCTTGTTCCT
GGAAAGTGAAAGGAAGTTCACCTGCTATGAGTGAGAAGGTGGACACACTGGGTGGGGATGAGGTGAGTGACATGAGCTTA
GGAAAGTTGCTGAGGTAATTGGTTGAGAGAGGTGTTCAAATAAAAGTAATGCAATTGGCAAAAACTGTTACTAAGACTTT
GTAGAGGCACAAATCAGTGACACGGCAGCATCTTCTTTCACAGTAATCAACTGCCAGATTGCAGGGAGCCTTGATACCAG
CCTAAGGAGTGTGAGTTTCTCCTCTAGGCCCACAGGTCCCCAACCTCACTTCTCCGAAGACTCTCCTGGAGATCATCTGT
GATGCGCAGATACCCAGACTCACTGCCCCGAGACTCAGATTCCCTGGGTAGGGAGGTCGGGGGATCTCTGCTTGTAATCA
GCTCCCTAGAGGTTCCCATGTAGCCGGATAAGTATTGTCAGAACACTGAAGATTTTTGAAAAATGAAAAAGCGAAGGTTG
GAGATGTGTCTTCAGAAGACTACTAAGGGTGCTGGGTAGAGGAGGGACCAGAGGCAGGGAAATGAGGTAGGAAACTGCTA
TTATTTGTCAGGGAAATTGCAATCAAGAAATGAGTTAGAACAGGGAAAAGACAGAGGCAGGGGAGAGGTGGAAGGGGGAG
GAAAGGAGTAGTGACAATTCCAGGGTGTATGCTCACCCAAATCTAGAAGTAATTGAGCAAATGTTTTCTGGGCATTAGAG
AAGGCAACTAGAACAAACAGGAATCCTTGCCTTGGTGAAATGTATTTGAACTGGGTCAGAAATGAGGCCATTGGGTATCA
AGCCTTAACTCCAGCGCCCCCTGGAGGTCGCTGATGTGGCTCCAGGCTGACCTGCTCCTGTCAAAGAATATTGAGCAAGA
TGCCTCTCATGGAATGTTCTGGGACCTTAAAACAGATACCCAAGTATTCCCCCTGATTTCATGGTTCCCAGAAGCTCTAT
GGGGAAGAAATTGTACGTAATTCACAACTGAGATTTAGACATAAGTTGAATAGTGTAATGGACGTTGAGTTAACCGAGGT
AATGAAGTAGTGAGACACAGGTGCCCCTGAAATAAACTCACATTGAGGGAAGAGGCTGACAATGTGGATCAGTCTGTAAA
CAAGGCAAAAATACAATAGGGAGTAAGGGTTGTGTGTCAGTTCAAGACTGTACTTTTACCTGGCCCAGCGCCATGTTGGG
GTATTTGTGTTCTCCAGGAAGTAGAAAGGAAAGAACTGAGTGATTAGGGACCTAGAAGACTAATTTGAGACATTCCTCTT
GATGAACTGTTCTCTAGGGTAGTCCTCTGAAAGAGCTGTTCTCTAGTGGATCTCCCTGAATGAACTGTTCTCTAGGAGCA
CTTGACCCTTTTCTGTGTTTGTTTTTTGTTTTGTGTTTGTGTTTGTTTTTGAGACAGGTTCTCGCTCTGTCTCCCAGGCT
GGAGTGCTGTGGCGCCATCATGACTCACTGCAGCCTCAACCTCCTGGGCTCAAGTGATCCTCCTGCCTCAGCCTCCCATG
TAGCTAGAACTACAGATACATGTACCACCATGTCTGGCTAATTTATTTTTCTTTTTAGAGATGGGTTCTCACTATGTTGC
CCAGGCTGGTCTCGAAACCCTGGGCTCAAGTGATCCTCACGCCTCAGCCTCCCAAAGTGCTAAGATTATAGGCATGACCA
CCATGCCTGGCCTTTTCTGCCTTCCGAGAAGGAAAAAGGTACTGGTGGCAGAGATCCAAAAGAAAAGTTGCCAGTGGCAG
TGTGGAAATTGACCTGAGAACAACAGAACAAGCTGGGGCACAAATGCAAAGATGCAGAGGGAGGCAACATCTGGTTATCT
GTGAGACCTTCATGGGACCTGAAGACACATCCTTTTGGAAAAGGATGGGATTTCTACTACTCAAGCATGTAGGGGCTCAG
GATATTATGTAAATATGAAGATTTTGAGTTTTTGTAAGTGAGGTAAAAAAAATACCTAGGTTATTTACAGAATAAGACAT
GTCAAGCTCTCTTCATTTTCTTTGTATTTTCATGAAATAAAGGTATTAGATTAACAGGCCACCATAATGCCATTGTCTGT
ATATCTTAATTTCAAGATATTATTTGAGTAATTTTTGCATCCTTTGTATCAAGATAGAACTTTGAAAAGACAGGTAATTT
CACAGTTGATTAAATATTCTTTGCCCAAATTACTTTTGGTTAAAATTTCTCCTATATGTGCTACAGAGTGCAAACTCTGT
CTCCCTGCCATTCCGCTATATACTTACTAATTATTATTTTATTCAAGATCATGCATGCTCTACTTGAAGGTCTATCTTTT
CAGTGCTACCCTTACCCACTAGCCTAATCACATTATATCTATTTTCAACATCTAGGAATCAATTACGTAGTGAACATGCC
TAAGAAATAATAATCTGGGCAGATGCAGTGGCTCAGGCCTGTAATCCCAGCACTTTGAGAGGCTGAGCGGGTGGATCACT
TGAGGTCAGGAGTTGGTCAAGTGCTCCTAGAGAACCAGCCTGACCAACATGGAGAAACCTTGTCTCTACTGATAATACAA
AAATTAGCCAGGTGAGGTGGCAGGCACCTATAATCCCAGCTATTCGGGAGGCTGAGGAAGGAGAATTGCTTGAACCCCTG
AGGTGGAGGTTGCAGTGAGCCAATATTGCGCCACTGCATTCCAGACTTGGCAACAGAGCGACACTCCACCTCAACAAAAA
GAAAGAAAGAGCGAGATTACGTCTCAAAAAAGGAAGGAAGGAAGGACAATCTCAAATGCTATTTCATTATTTTCCTTCCC
CACTCGTAGTCCAGCCTAAGGTGAACGTTTCCCCCTCCAAGAAGGGGCCCCTGCAGCACCACAACCTGCTTGTCTGCCAC
GTGACAGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTGAATGGACAGGAGGAAACAGCTGGGGTCGTGTCCAC
CAACCTGATCCGTAATGGAGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACCCCCCAGCAGGGAGACGTCTACA
TCTGCCAAGTGGAGCACACCAGCCTGGACAGTCCTGTCACCGTGGAGTGGAGTGAGTCTCTGATGACCGTCTAGACCCCA
CCTCTGAAGAGCAGGGGACTCTCTGGCTCTGGGGTCCACTCATCTTATCTTCTGCATCTATACCCTGGGGCCATGTCCAA
ACCCCATCTTTCTTCTATACCAGCTCCTGAGCATAGTTTGAAGCCAGGGCAATGGAGACTTCCTGACCTTGGCTTAGGGG
TTCCTGAAGATTCATAGTTCTCCCCCTTGTCAGAGAATCTAGGGACACTGGCTGATCTCGAAACCCTCACACACAGGAAC
TGACCTCACACATAGGAACAGTTCTCTTCTTTCAGCATTTTAGCCTCTTCTCAGGCATTTTGAGAGGCAACTTCTAGAAT
CAGCATTTGCCACCTTGTTGAGGTCACACCCCTGTTCCGGACATGAGGGTGGCTCTTTCTGAATTTCCTCTTAGCAAGCT
TTTTCCCCTGCACTGTCTTCATCCCGATATTCTGCATCACGCTCCAGAATCTCAGACAGGACATGAGTAGGGATGCAGCT
GGTGGAGGTGACACTAAACCTGGGTCTGTCCTTCCCAGAGGCACAGTCTGATTCTGCCCGGAGTAAGACATTGACGGGAG
CTGGGGGCTTCGTGCTGGGGCTCATCATCTGTGGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGGTGAGAAAGCC
TGCAAGGTGAGCGGGACTTACCTTCCCCTGGCATATTCACACTTACTCCATGATGAGGGTTCAGACAGAAAAGAAATGTC
AGAAAGCTCTAGAGACCACTGAAATCAGATAGTCGGGGAACAAACATGACCTATGGCGAGAGGGGGATCCCAGGCTGGGA
TCTTAATGCAGCCAGATGCATGAGGTCCCAGGTGCTCAGACTCCTGCGGGGCATCCATTGAGTGGTGGTCAATGGAATTT
GGTGGGATGGAAATGTTTCTCTAACTATCTGAGGTGGTTTCAATGGCTGAATACATAACCTTTCCTCTTTCATTTCAGTT
CAACGAGGATCTGCATAAACAGGTAATATTCCTGCTTTGATTTCCTTGGGGGGTGGGTTACAGGAGGATATGACTCTTTT
CTGTGCATTGTAATACTGAGGCTCCTCCAGGAAGGGAATCTCAGGCATGAACCCCTCTTTCAACCTCGGCTCTCGGGTGA
GTGGGGAAAAAGCATTGCACGGCTCCATTGCTGAAGGAAGCAGAGATCAGTTCTGTTCTTTATCAGCCTAAGATGCAGCC
TCTCACCATAATTTTTCTCTCCTGGACTTAAAGGAAGGAGGCCAGCAACCTGGGATAACTTGTCCTTTACCCCCACAGGG
TTCCTGACCTCACCGAAAAGACTAATGTGCCTTAGAACAAGCATTTGCTGTGTTTTGTTAGCACCTGGTTCCAGGACAGA
CCCTCAGCTTCCCAAGAGGATACTGCTGCCAAGAAGTTGCTCTGAAGTCAGTTTCTATCGTTCTGCTCTTTGATTCAAAG
CACTGTTTCTCTCACTGGGCCTCCAACCATGTTCCCTTCTTCTTAGCACCACAAATAATCAAAACCCAACATAAGTGTTT
GTTTTCCTTTAAAAATATGCATCAAATCGTCTCTCATTACTTTTCTCTGAGGGTTTTAGTAAACAGTAGGAGTTAATAAA
GAAGTTCATTTTGGTTTACACGTAGGAAAGAAGAGAAGCATGAAAGTGGAGATATGTTAACTATTGTATAATGTGGCCTG
TTATACATGACACTCTTCTGAATTGACTGTATTTCAGTGAGCTGCCCCCAAATCAAGTTTAGTGCCCTCATCCATTTATG
TCTCAGACCGCTATTCTTAACTATTCAATGGTGAGCAGACTGCAAATCTGCCTGATAGGACCCGTATTCCCACAGCACTA
ATTCAACATATATCTTACTGAGAGCATGTTTTATCATTACCATTAAGAAGTTAAATGAACATCAGAATTTAAAATCATAA
ATATAATCTAATACACTTTAA

IMGT/HLA

Sponsors

Animated Sponsors Logo