Allele Report for DPB1*102:01

DPB1*102:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*0302 Local Names: HLA-DPB1*31 variant
IMGT/HLA Acc No: HLA01947 OMIM Entry: *142858
Assigned: 2004-06-25 Sequence Last Modified: 2004-07-08
Source Entries: AY618897  
Cells Sequence Derived From: 03-82  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Sheldon MH et al. Tissue Antigens 66:64-6 2005. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (84 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDLLEEKRAVPDRMCRHNYELDE
AVTL
Nucleotide Sequence Data (256 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGTTCGCGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGCTGCGGAGTA
CTGGAACAGCCAGAAGGACCTCCTGGAGGAGAAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGACG
AGGCCGTGACCCTGCA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo