Allele Report for DPB1*101:01

DPB1*101:01 View HGVS Report
Pre-2010 Nomenclature: DPB1*0203 Local Names: HLA-DPB1
IMGT/HLA Acc No: HLA01895 OMIM Entry: *142858
Assigned: 2004-04-30 Sequence Last Modified: 2004-07-08
Source Entries: AY572830  
Cells Sequence Derived From: 04-9525502  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (87 aa)
NYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTELGRPEAEYWHSQKDILEEERAVPDRMCRHNYELGG
PMTLQRR
Nucleotide Sequence Data (264 bps)
AGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAAC
CGGGAGGAGCTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGAGGCGGAGTA
CTGGCACAGCCAGAAGGACATCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCG
GGCCCATGACCCTGCAGCGCCGAG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo