Allele Report for DPB1*02:02

DPB1*02:02 View HGVS Report
Pre-2010 Nomenclature: DPB1*0202 Local Names: DPB2.2
IMGT/HLA Acc No: HLA00519 OMIM Entry: *142858
Assigned: 1989-08-01 Sequence Last Modified: 2005-01-12
Source Entries: AF492642 , AL805913 , AL845446 , AY656678 , AY831404 , M23678 , M62329 , X72071  
Cells Sequence Derived From: 99101422 , DUCAF , HM-K , QBL  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Reinders J et al. Immunogenetics 57:790-4 2005. (View abstract)
Bugawan TL et al. J Immunol 141:4024-30 1988. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 4 Laboratories: 6
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (258 aa)
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTEL
GRPEAEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFL
NGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
Nucleotide Sequence Data (777 bps)
ATGATGGTTCTGCAGGTTTCTGCGGCCCCCCGGACAGTGGCTCTGACGGCGTTACTGATGGTGCTGCTCACATCTGTGGT
CCAGGGCAGGGCCACTCCAGAGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCGTTTAATGGGACACAGCGCTTCC
TGGAGAGATACATCTACAACCGGGAGGAGCTCGTGCGCTTCGACAGCGACGTGGGGGAGTTCCGGGCGGTGACGGAGCTG
GGGCGGCCTGAGGCGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGGAGGAGCGGGCAGTGCCGGACAGGATGTGCAG
ACACAACTACGAGCTGGGCGGGCCCATGACCCTGCAGCGCCGAGTCCAGCCTAGGGTGAATGTTTCCCCCTCCAAGAAGG
GGCCCTTGCAGCACCACAACCTGCTTGTCTGCCACGTGACGGATTTCTACCCAGGCAGCATTCAAGTCCGATGGTTCCTG
AATGGACAGGAGGAAACAGCTGGGGTCGTGTCCACCAACCTGATCCGTAATGGAGACTGGACCTTCCAGATCCTGGTGAT
GCTGGAAATGACCCCCCAGCAGGGAGATGTCTACACCTGCCAAGTGGAGCACACCAGCCTGGATAGTCCTGTCACCGTGG
AGTGGAAGGCACAGTCTGATTCTGCCCGGAGTAAGACATTGACGGGAGCTGGGGGCTTCGTGCTGGGGCTCATCATCTGT
GGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGTTCAACGAGGATCTGCATAA
Genomic Sequence Data (11528 bps)
TAATCCCTGTAGATGGGCCAGCAGAATATTTGAGATCACCTTCAGAGCAAAGAAAACGCATAATCTCGCCAAACATCATG
ACTTATCTGACTGGTTAAAATGAGTATCACTGTCTTTCCTCCGTCATCTTAAGTGCATCACAGGCTTTATATTTTCAGAC
CTTTCATACTAACTTTCTGCCTAGTGAGCAATGACTCATACAAAGCTCAGTGTCCATTGGTTCTTTTCTCAGACTCTGTC
CAATCCCAGGGTCACAGAAGACTACTTGGGTTCATGGTCTCTAATATTTCAAACAGGAGCTCCCTTTAGCGAGTCCTTCT
TTTCCTGACTGCAGCTCTTTTCATTTTGCCATCCTTTTCCAGCTCCATGATGGTTCTGCAGGTTTCTGCGGCCCCCCGGA
CAGTGGCTCTGACGGCGTTACTGATGGTGCTGCTCACATCTGTGGTCCAGGGCAGGGCCACTCCAGGTAAGAGCCGAACT
GCCATTCTTGGAGGGTCTGGCTCAGGGAACAATTCCTAGGGGACGTTATCTTTAAGGGATCAAATTCTGAGACAGGCTGC
GGGGGCTCCTGCCCTAAGGCAGTGTCCTCTCTTCCCAGCTAGAGAAAGAGGTTCATCCCCTATAGGATAGCTTGCTACCC
TACTGGCCTATTCTCTCTCCAAGGACATGGGTACAGTAAACAGAGAGAGGTGCCCAGTGGTCAGTATGCTTGTCTTTGGG
GAAAATGGGACCAAGAGGTCCTGGATAACCTTGGACAGACAAGGTTTGCAGAGAGAGAAGTTGGCAAGTGCAGGCTCCTG
GGCGTGTTCATGTCTGCATCCAGCCTGGAGGGGACTCAGGCAGAGAGCCCTAAGCTGGAGTGTCCAGGCTCTGAGGATCA
CTGAGGATTCAGTGCTCACGAAGAATGCCTCTTATTCCCCAGGGTGGAGCAGGAGCCCACATCCCTTGGACAATTAAGGA
GAGAAGGGAGGGAGGGGGATAGGTTTTAGCCCCTGAAGGCATTCTCATTAAAGGTACTTCTCCCAGCCTCCCCAGAACTT
GGTTAGGGTACTAGAGTGGGTTGCGACTTGTAGGAAGAATGAGATGAGGTTGTGTGGGTGCATGACAGGGATTGAGTGTA
GGTTATCAGACAGCCAAGGAAGCAGTAACCAAGTGAAAAATCTCTTCTTCCTGCTGCCTCCCTGTGGCTGGTGTAATATT
ATGGCATCTATGATCCATTGTTTTTCTCTCAGGATACTCTCAGGATATTTCTTTTTATATATATATATACTTTAAGTTCT
AGGGTACATGTGCACAACGTGCAGGTTTGTTACATATGTATACATGTGCCATGTTGGTGTGCTGCACCCATTAACTCGTC
ATTTACATTAGGTATATTTCCTAATGCTATCCCTCCCCCCTCCCCCCACCCCACAACAGGCCCCGGTGTATGATGTTCCC
CTTCCTGTGTCCATGTGTTCTCATTGTTCAGTTCCCACCTATGAGTGAGAACATGTGGTCTTTGGTTTTTTGTCCTTGCA
ATAGTTTGCTGTGAATGATGGTTTCCAGCTTCCTCCATGTCCCTACAAAGGACATGAACTCATCCTTTTTTATGGCTGCA
CAGTATTCCATGGTGTATATGTGTGCATTTTCTTAATCCAGTCTATCACTGATGGACAGTTGGGTTGGTTCCAAGTCTTT
GCTATTGTGAATAGTGCCGCTATAAACATATGTGTGCATGTGTCTTTATAGCAGCATGATTTATAATCCTTTGGGTATAT
ACCCAGTAATGGGATGGCTGGGTCAAATGGTATTTCTAGTTCTAGATCCTTGAGGAATTGCCACACTGTCTTGAGATACC
ATCTCACACCAGTTAAAATGGCGATCATTAAAAAGTCAGGAAACAACAGGTGCTGGAGAGGATGTGGAGAAATAGGAACA
CTTTTACTCTGTTGGTGGGACTGTAAACTAGTTCAACCATTGTACTCTCAGGACATTTCTAGTCCAAATTTACACCAACA
CTCTGAGAGGAAGGACTGCAAAGTAGGTACCTTAGTTTTCCACTGACTTCCACTTTTCCTGCTTACACCCTTCCTCCTAG
ACCTCTCCACACCCCTCCTAGGACACACCTAAAAGGTACTGACATCATGTCACCTCCTCATCTTTCAGGGTAGCAAGGTT
GGAATCTCCTGAATACAGCCCCTCAAGCCCTAAAACCTCTTATCTATTACCTTGGGTTCATTGTCCAGGAAGGGGAGGAG
AACTTGAACTTGTAGTCACAGAAGGGTGCTGAGAACTAACCAGCAGGACGGCTCAGCCCTGGGAACTGCAGAGGGGTGAG
GCTGGGGAGAGAGGAGGCTGGAGCAGCACTGGTGACACTGAACAGTGTCAGGAGGAAGTGACGGATGCAGCGCCCCCATC
CCATAGGCAGAGCTGTCATGTGGGATGAGGGACAGTGTTGGGAGCCACCAAGGAAACCCAGAGGTGGGGGAGCAGAGAGC
AGAAGGGAGCATGTGATGCTGGACAGTGAAAGGGAGGACAGGCAAAGGCTGGGTTGAGGTTTGTAGGGGGAATGAGATGA
GGCAGTGGAGCCATGTGACAGGGACTGAGGGTAGATTACTGGAGCTCCCTGCGTAGAATGAATGTTCAATCAAAATTTGC
TGGAGGGAGAGCTGGAGCCATAGGGGAGTGGGTAAAGTGGGCAGGGCTGATTCCACAATTCCCTGCATGCTCCCCCAACT
CCACACACATCCCCAACCTCAAACAGGGCACAAGACCAAAGGGCTGAGGAGCCAGGCTATAGCTTAAAGAGGCTGGGGGA
GAAAAGCTTGGCTGAGACAACCCATAGGGAGCTAGAGGTTTTTAATATATCCTATTCTGAATAAGAGACGAATTCATTCA
GATCAGTGGTTTCAAACCGTGCTCTGGGCAACTCAATTGCTAAGGGTTCCACAAACAGGATAAAGTTTCTTATATACAAA
AAAAAATGAAGGTTTCAAATTACACCATAAAACCCCTCATTGCTTATGTCTACTTGGCAGGTAAAATTCCATTTCAAAAG
TTAAATGTACTTAAAAAATTACCTAAGACTGGGTAAATTAAAAAAATTAAATGTTGCAAAGAAAAAATTCAAAATTCTTA
TTCTTGAATGAAAAACGTTCTCTTACTGGTGATTGAGGAGGAGAAACAAAGACTAACAAATGAAAATGGGAGAATCCACA
CTCAGAGTGGGGCAACTGAACAGGCAGGGGCGGATGGATGGCAGAGGAGGAGGAATCTGGACTCAAGGAGCTGGGGGGCT
CTGGGCCTGGAATTTTAGGGTCTGGGGCCCAAGGCACCAGGAGAAGAGGCAGGTCAGGATATCTGAGTCAAGACCTGGGA
TCTTGCCTTAGCAATGACACTGGAGACTAAAGGTGGACTCCATGGTGCCCTTGAGCCCAGCCCTACCCCATCTCCACTAT
CCTCTGCCACCAGCTGTGCAACTTCTGCTAGGGGTGAGGTTAATAAACTGGAGAAGTTAATTTGTGGAGCATGAAACAGA
TGAGCAGAACAATCACAGCACCTTAATTTCCCCAGTGTGCCCAAGAACAGAGCAGGCCTGAAGATACTCAAACAGAAACA
AACATGTGCCGTGTCACTGATAATTCTGTGTAGACACACACCTGCCAGACACTGCTCATGGCACTCCCTAGGAAGAACAG
CATGTGGGAAAGGCTGCCAAAATTGTTCATGTAAAAATTACATCAATGCTGTCTTCCTCGGTGCTGCCTATGCAGCTGGC
AGCCATCTCTTCCTCCACATCATGGCCTCCCTCAGACTCCTCATGAAGGATAAGATCCTCAAAAAGAGGACCAACAAGTT
CATGAGGCACCAATCAGACTGAAATGTCAAAATTAAGCATAACTGGCGGAAACCCAGAGGTCTTAACAGTAGGGTTCGTA
GAAGGTCCAAGGGCCAGATCTTGATGCCCAACATTGCTTATGGGAGCAACAACAACAACAAAAAAAACATGCTGCCCAGT
GGCTTCCAGAAGTTTCTGGTCCACAGCCTCAAGGAGCTGAAAGTGCTGCTGATGTGCAACAAATCTTACTGTGCTGAGAT
CGCTCACAAAATTTCCTCCAGAACTGCAAAGTCATCATGGAAAGAGTCACCCAGCCGGCCATCAGAGTCACCAACCCCAG
TACCAGGGTGCACAGCTAAGAAAATGAGTAGAAAGTTCATGTCCACGTTTTGTGTGTAAATAAAACCATAAAAACTGCCA
AAAAAAATTACATCAATGCCTCTAAACCCAAAGGACTCTACCCCCACAGGTCCCTGGTTGTTGTGGTGATTTTCATTGTG
TAAAATACTTTCCACATCTTTTGACACCAAGTCTTTCTGCAGCCATGTTTGAAAATTAACTTTCAGGCTACAGAGTCTTT
CTTATACCAAAGTTGAAGAAAGTTTTAAGAAATATATTTCTACATCTCCTACATGCAAAACAACAGGAGCAAGTTGAGGA
ATTCTCAAGAAACTGGTCGAGAAGAGAGAGCGCTTAGCTATGGAAAAGAGAAAGAAGGAAGGGAGGGCTTCCTGGAGGAG
GTGGCATTTGAACCAGGACTGACATCAGGATGGAAATGTCAGTCAGGGAGTTAAGTAGGGGGAGCAGCTCCGCCCTCCAC
GTCCCCAGCTCCTCCCGCCCCTGTTTTTTCTCCCAGTGACCCCACGTGAAACGTCTCCGCCTCCTCCAGCCACCAGCAGA
AGGGACTGCCTTCCCCTCAGTGCTCGCCCCTCCCTAGTGATCACTCAGTGCCCCTGAGCTCATTCTTTTCAGTAAATTCT
CTCTCTGCGTGGTGAGAAAACAGGCCTGGAGAGGCTCTGCGACCCGCTTAGGACCACAGAACTCGGTACTAGGAAAACTC
CTATTTTAAAATCCAGCCCTGGGTGGGAAGATTTGGGAAGAATCGTTAATATTGAGAGAGAGAGGGAGAAAGAGGATTAG
ATGAGAGTGGCGCCTCCGCTCATGTCCGCCCCCTCCCCGCAGAGAATTACCTTTTCCAGGGACGGCAGGAATGCTACGCG
TTTAATGGGACACAGCGCTTCCTGGAGAGATACATCTACAACCGGGAGGAGCTCGTGCGCTTCGACAGCGACGTGGGGGA
GTTCCGGGCGGTGACGGAGCTGGGGCGGCCTGAGGCGGAGTACTGGAACAGCCAGAAGGACATCCTGGAGGAGGAGCGGG
CAGTGCCGGACAGGATGTGCAGACACAACTACGAGCTGGGCGGGCCCATGACCCTGCAGCGCCGAGGTGAGTGAGGGCTT
TGGGCCGGCGGTCCCAGGGCAGCCCCGCGGGCCCGTGCCCAGGGCGCAGGAGCAGCCGGGTTGGCCTAAGGGACCTTAGT
GCCGGGCGGAAAGGGGACTTTGGGTTGGGGATTCATGGGGGGAGCCCATCTGGAGCTTGTCAGGGGAGCGAGCGCGGGGA
CCTGGACTGGGCTGAGCATGGAGTGAGGAGGACGAGAGCAGAGAGACCCCCGGGACTTCATCAGGCCTGGCAGCTGACTG
CATGTGGGGTGAAAAAAGGAAGCCACAGGACAGCGCACAAGGGTATGGTGTGGAGATGGAGGTGGAGATGGCACAGCAGG
CCACACAGAGAAGAAACCTACAGGGAGGTAGCTGGGTTTGAGGTGCTTGAGGGGCAGATGGGTGGTCTGATGGGCAGGTA
GACAGAAGGGTCTGCAGCCGGGGAGGAGACTGAGATACATGAGACCATCCAGGGAGAGGGGACCCAGGGGGAAGAGCAAA
GGACCGGATCCTGGGAACTGGACAGTTGTGATTTGGCCAAGACAGAAAAGCCTGTGAAAGAGACCAAAAAAACCCAAGTG
CAGTGTGAGGAGAGGCCCGCAGAGAAGAGTCTTGGAAGCTGAGGGGAGGTGACCTCAGCAGCACAGTGGACAGCGGTGCC
AGTGACTTGGGAAGGTCAGAAAACAGAAGATGGAAAGTGGGTTTGGAAACCAGGGAGACCTGGGGAGAGCAGGTTGGCCG
CAGCGGCAGGAGCTGGAATGGGAGGGGGTGCATGAGGCTGAGTGTGGCGCATCCTCCTCGGGGCTGAGATGGATTTTACT
TGTCTTGGGTTCCCCACGGCTGTCACAGGGCAGTGTCTCAGTTCATTCGTCTTTTTCCTTCAGGAAGTCTGGGTGTAAAG
GGATGGAGAGAGGTGAGGTGTGTGCAGTAAGAGGATTTCTCAAGGATGGGACAGGAAGGCCTTGGAGCTTTGGCTTCCTC
CTGTGAACTTGTGGGGTGGGGAGCCTGGTGCACCAACCTGAGGGACTTGAGGGAGTAGTATCAGGATGTGGGATTGAGCC
CTGGACCTTTTTTCTAGAAAGAGGAAAAAAATGAAGGGAGGAGGAGGAGGAAGCTGGGGAGATCACACCTTTGATTTTCT
TGTTCCTGGAAAGTGAAAGGAAGTTCACCTGCTATGAGTGAGAAGGTGGACACACTGGGTGGGGATGAGGTGAGTGACAT
GAGCTTAGGAAAGTTGCTGAGGTAATTGGTTGAGAGAGGTGTTCAAATAAAAATAACGCAATTGGCAAAAACTGTTACTA
AGACTTTGTAGAGGCACCAATCAGTGACATGGCAGCATTTTCTTTCACAGTAATCAACTGCCAGATTGCAGACAGCCCTG
ATGCCAGCCTAAGGAGTGTGGGTTTCTCCTCCAGGCCCGCAGGTCCCCAACCTCACTCCTCTGAAGACTCTTCTGGAGAT
CCTCTGTGATGCACAGATCTCCAGACTCAGTGCCCCCAGACTCAGATTCCCTGGGTGGGGAGGTCTGGGGATCTCTGCTT
GTAATCAGCTCCCTAGAGGTTCCCATGTAGCCAGATAAGTATTGTCAGAACACTGAAGATTTTTGAAAAATGAAAAAGAG
AAGGTTGGAGATGTGTCTTCAGAAGACTACTAAGGGTGCTGGCTAGAGGAGGGACCAGAGGCAGGGAGATGAGGTAGGAA
ACTGCTATTATTTGTCAGGGAAATTGCAATCAAGGCATGAGTTAGAACAGGGAAAACACAGAGGCAAGGGAGAGGTGGAA
GGGGGAGGAAAGAAGTAGTGACAATTCCAGGGTGGATGTCCACCCAAATCTAGAAGTAATTGAGCAAATGTTTTCTGGGC
ATTAGAGAAGGCAACTAGAACAAACAGGAATCCTTGCCTTGGTGAAATGTATTTGAACTGGGTCAGAAATGAGGCCATTG
GGTATCAGGCCTTAACTCCAGCGCACCCTGGAGGTCACTGATGTGGCTCCAGGCTGACCTGCTCCTGTCAAAGAATATTG
AGCAAGATGCCTCTCGTGGAATGTTCTGGGACCTTAAAACAGATACCCAAGTATTCCCCCTGATTTCATGGTTCCCAGAA
GCTCTATGGGGAAGAAATTGTAGGTAATTCACAACTGAGATTTAGACATAAGTTGAATAGTGTAATGGACATTGAGTTAA
CCGAGGTAATGAAGTAGTGAGACACAGGTGCCCCTGAAATAAACTCACATTGAGGGAAGAGGCTGACAATGTGGATCAGT
CTGAAAACAAGGCAAAAATACAATAGGGAGTAAGGGTTGTGTGTCAGTTCAAGACTGTACTTTTACCTGGCCCAGCGCCA
TGTTAGGGTATTTGTGTTCTCCAGGAAGTAGAAAGGAAAGAACTGAGTGATTAGGGACCTAGAAGACTAATTTGAGACAT
TCCTCTTGATGAGCTGTTCTCTAGGGTAGTCCTCTGAAAGAGCTGTTCTCTAGTGGATCTCCCTGAATGAACTGTTCTCT
AGGAGCACTTGACCCTTTTCTGTGTTTGTTTTTTGTTTTGTGTTTGTGTTTGTTTTTGAGACAGGTTCTCACTTTGTCTC
CCAGGCTGGAGTGCTGTGGCACCATCATGGCTCACTGCAGCCTCAACCTCCTGGGCTCAAGTGATCCTCCTGCCTCAGCC
TCCCATGTAGCTAGAACTACAGATACACGTACCACCATGTCTGGCTAATTTATTTTTCTTTTTAGAGATGGGTTCTCACT
ATGTTGCCCAGGCCGGTCTCAAAACCCTGGGCTCAAGTGATCCTCATGCCTCAACCTCCCAAAGTGCTAAGATTATAGGC
ATGACCACCATGCCTGGCCTTTTCTGCTTTCTGAGGAGGAAAAAGGTACTGGTGGCAGAGATCCAAAAGAAAAGTTGCCA
GTGGCAGTGTGGAAATTCACCTGAGAACAACAGGACAAGCTGGGGCACAAATGCAAAGATGCAGAGGGAGGCAACACCTG
GTCATCTGTGAGACCTTCATGGGACCTGAAGACGCAGCACAGAGGAGGAACTTGAAAAAGGACGGGATTTCTACTACTCA
AGCATGTAGGAGCTCAGGATATTCTGTAAATATGAAGATTTTGAGTTTTTGTAGGTGAGGTAAAAAAATACATAGGTTTT
TTACAGAATAAGACATGTAAAGCTCTCTTCATTTTCTTTGTATTTTCATGAAGTTATTAGATTCACAGGCCACCATAATG
CCATTGTCTGTATATCTTAATTTCAAGATATTATTTGAGTAAATTTTGCTTCCTTTGTATCAAGATAGAACTTTGAAAAG
GTAGGTAATTTCACAGTTGATCAAATATTCTTTGCCCAAATTACTTTTGGTTAAAATTTCTCCTAAATGTGCTACAGAGT
GCAAACTCTGTCTCCCTGCCATTCCGCTATATACTTACTAACTATTATTTTATTCAAGATCATGCATGCTCTACTTGAAG
GTCTATTTCTATCTTTTCAATGCTACCCTTACCCACTAGCCTAATCACATTATTCCTATTTTCAACATCTAGGAATCAAT
TACATAGTGAACATGCCTAAGAAATAATAATCTGGGCAGATGCAGTGGCTCAGGCCCGTAATCCCAGCCCTTTGAGAGGC
CGAGCGGGTGGATCACTTGAGGTCAGGCGTTGGTCAAGTGCTCCTAGAGAACCAGGCTGACCAACATGGAGAAACCTTGT
CTCTACTAATAATACAAAAATTAGCCAGGTGAAGTGGCAGGCACCTATAATCCCAGCTATTCGGGAGGCTGAGGAAGGAG
AATTGGTTGAAGCCCAGAGGTGGAGGTTGCAGTGAGCCAATATTGCGCCACTGCATTCCAGACTTGGCAACAGAGTGACA
CTCCATCTCAACAAAAAGAAAGAATGAAAGAAAGAAAGAGCGAGATTATGTCTCAAAAAAAAGGAAGGAAGGAAGGAAGG
AAGGAAGGAAGGAAGGAAGGAAGGAAAGAAGGACAATCTCAAATTCTATTTCATTATTTTTCTTCCACGCTCCTAGTCCA
GCCTAGGGTGAATGTTTCCCCCTCCAAGAAGGGGCCCTTGCAGCACCACAACCTGCTTGTCTGCCACGTGACGGATTTCT
ACCCAGGCAGCATTCAAGTCCGATGGTTCCTGAATGGACAGGAGGAAACAGCTGGGGTCGTGTCCACCAACCTGATCCGT
AATGGAGACTGGACCTTCCAGATCCTGGTGATGCTGGAAATGACCCCCCAGCAGGGAGATGTCTACACCTGCCAAGTGGA
GCACACCAGCCTGGATAGTCCTGTCACCGTGGAGTGGAGTGAGTCTCTGATGACCCTCTAGACCCCACCTCTGAAGAGCA
GGGGACTCTCTGGCTCTGGGGTCCACTCATCTTATCTTCTGCATCTATACCCTGGGGCCATGTCCAAACCCCATCTTTCT
TCTATACCAGCTCCTGAGCATAGTTTGAAGCCAGGGAAATGGAGACTTCCTGACCTTGGCTTAGGGGTTCCTGAAGATTC
ATAGTTCTCCCCCTTGTCAGAGAATCTAGGGACACTGACTGGTCTCGAAACCCTCACACTTAGGAACTGACCTCACACAT
AGGAACAGTTCTCTTCCTTCAGCATTTTAGCCTCTTCTCAGGCATTTTGAGAGGCAACTTCCAGAATCAGCATTTGCCAC
CTTGTTGAGGTCACACCCCTGTTCCAGATATGAGGGTGGCTCTTTCTGAATTTCCTCTTAGCAAGCTTTTTCCGCTGCAC
TGTCCTCATCCCGATATGCTGCATCAGGCTCCAGAATCTCAGACAGGACATGAGTAGGGATGCAGCTGGTGGAGGTGACA
CTAAACCTGGGTCTGTCCTTCCCAGAGGCACAGTCTGATTCTGCCCGGAGTAAGACATTGACGGGAGCTGGGGGCTTCGT
GCTGGGGCTCATCATCTGTGGAGTGGGCATCTTCATGCACAGGAGGAGCAAGAAAGGTGAGAAAGCCTGCAGGGTGAGCG
GGACTTACCTTCCCCTGGCATATTCACACTTATTCCACGATGAGGGGTTTGACAGAAAAGAAATGTCAGAAAGCTCTAGA
GGCCACTGATATCAGATAATCGGGGAACAAACATGACCTATAGCGAGAGAGGGATCCCAGGCTGGGATCTTAATGCAGCC
AGATGCATGAGGTCCCAAGTACTCAGGCTCCTGCGGAGCGTCCATTGAGTGATGGGCAATGGAATTTGGTGGGATGGAAA
TGTTTCTCTAATTATCTGAGGTGGTTTCAATGGCTGATTATATAACCTTTCGTCTTTCATTTCAGTTCAACGAGGATCTG
CATAAACAGGTAATATTCCTGCTTTGATTTCCTTGTGGGGTGGGTTGCAGGAGGATATGAGTCCTTTCTGTGCATTGTAA
CACTGAGGCTCCTCCAGGAAGGGAATCTCAGGCATGAACCCCTCTTTCAATGTCAGCCTTCAGGCAAGTGGGGAAAGAGC
ATTGCTTGGCTCCATTGCTGAAGGAAGCAGAGATCAACTCTGTTATTTATCAGCCTGAGACGCATCCTCTCACCATAATT
TTTCTCTCCTGGACTTACAGGAAGGAGGCTGGCAACCTGGGATAACTTGTCTTTTACCCCCACAGGGTTCCTGAGCTCAC
TGAAAAGACTATTGTGCCTTAGGAAAAGCATTTGCTGTGTTTCGTTAGCATCTGGCTCCAGGACAGACCTTCAACTTCCA
AATTGGATACTGCTGCCAAGAAGTTGCTCTGAAGTCAGTTTCTATCATTCTGCTCTTTGATTCAAAGCACTGTTTCTCTC
ACTGGGCCTCCAACCATGTTCCCTTCTTCTTAGCACCACAAATAATCAAAACCCAACATGACTGTTTGTTTTCCTTTAAA
AATATGCACCAAATCATCTCTCATCACTTTTCTCTGAGGGTTTTAGTAGACAGTAGGAGTTAATAAAGAAGTTCATTTTG
GTTTAAACATAGGAAAGAAGAGAACCATGAAAATGGGGATATGTTAACTATTGTATAATGGGGCCTGTTACACATGACAC
TCTTCTGAATTGACTGTATTTCAGTGAGCTGCCCCCAAATCAAGTTTAGTGCCCTCATCCATTTATGTCTCAGACCACTA
TTCTTAACTATTCAATGGTGAGCAGACTGCAAATCTGCCTGATAGGACCCATATTCCCACAGCACTAATTCAACATATAC
CTTACTGAGAGCATGTTTTATCATTACCATTAAGAAGTTAAATGAACATCAGAATTTAAAATCATAAATATAATCTAATA
CACTTTAA

IMGT/HLA

Sponsors

Animated Sponsors Logo